KEGG   Massilia sp. NR 4-1: ACZ75_08160Help
Entry
ACZ75_08160       CDS       T04026                                 

Definition
(GenBank) phosphatidylserine decarboxylase
  KO
K01613  phosphatidylserine decarboxylase [EC:4.1.1.65]
Organism
mnr  Massilia sp. NR 4-1
Pathway
mnr00564  Glycerophospholipid metabolism
mnr01100  Metabolic pathways
mnr01110  Biosynthesis of secondary metabolites
Module
mnr_M00093  Phosphatidylethanolamine (PE) biosynthesis, PA => PS => PE
Brite
KEGG Orthology (KO) [BR:mnr00001]
 09100 Metabolism
  09103 Lipid metabolism
   00564 Glycerophospholipid metabolism
    ACZ75_08160
Enzymes [BR:mnr01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.65  phosphatidylserine decarboxylase
     ACZ75_08160
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PS_Dcarbxylase
Motif
Other DBs
NCBI-ProteinID: AKU21455
UniProt: A0A0K1JWH1
Position
2183261..2184106
Genome map
AA seq 281 aa AA seqDB search
MSDRLAVLPQYLLPKTALTNFAGRVAGAKGGAMTTRLIRWFVGKYDVNMAEAANPDIASY
HSFNDFFTRALKPGARPLAEADLVCPVDGRISQFGAIEDDQIFQAKGHRFSTTALVGGDR
ALAAHFQHGSFANLYLSPRDYHRIHMPCDGKLTRMIYVPGELFSVNPTTARGIPGLFARN
ERVVCVFETAVGPFVMTLVGATIVGSMATVWHGVVNPPRQPDVCEWTYADQNIVLKKGEE
LGRFLLGSTVVMLFPKDTLHFNAQWQPAGPVRLGECMANLK
NT seq 846 nt NT seq  +upstreamnt  +downstreamnt
gtgtccgaccgacttgctgtattgccgcaatatctgctgcccaagaccgccctcaccaac
ttcgccggccgcgtggcgggcgccaaaggcggcgccatgaccacccgcctgatccgctgg
ttcgtaggcaaatacgatgtgaacatggccgaggcggccaatccggacatcgccagctac
cacagcttcaacgatttcttcacgcgcgcgctgaagcccggcgcgcgtccgttggccgaa
gccgacctggtgtgcccggtcgacggccgcatcagccagttcggcgccatcgaggacgac
cagatcttccaggccaaaggccatcggttcagcaccacggccctggtgggcggcgaccgc
gcgctggcggcccatttccagcacggcagctttgccaacctctacctgagtccacgcgat
taccaccgcatccacatgccttgcgacggcaagctgacgcgcatgatctatgtgccgggc
gagctgttctcggtgaacccgaccacggcgcgcggcattcccggcctgttcgcccgcaac
gagcgcgtggtatgcgtgttcgagacggccgtcggccccttcgtcatgaccctggtgggc
gccaccatcgtcggcagcatggccaccgtctggcatggcgtggtcaatccgccgcgccag
cccgatgtgtgcgagtggacttatgccgaccagaatatcgtgctgaaaaaaggcgaggaa
ctgggccgcttcctgctcggctccaccgtggtgatgctgttcccgaaagacaccctgcat
ttcaacgcgcaatggcagccggccggcccggtgcgcctgggcgagtgcatggcaaacctg
aagtaa

DBGET integrated database retrieval system