KEGG   Massilia sp. NR 4-1: ACZ75_14400Help
Entry
ACZ75_14400       CDS       T04026                                 

Definition
(GenBank) glutathione peroxidase
  KO
K00432  glutathione peroxidase [EC:1.11.1.9]
Organism
mnr  Massilia sp. NR 4-1
Pathway
mnr00480  Glutathione metabolism
mnr00590  Arachidonic acid metabolism
mnr01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:mnr00001]
 09100 Metabolism
  09103 Lipid metabolism
   00590 Arachidonic acid metabolism
    ACZ75_14400
  09106 Metabolism of other amino acids
   00480 Glutathione metabolism
    ACZ75_14400
Enzymes [BR:mnr01000]
 1. Oxidoreductases
  1.11  Acting on a peroxide as acceptor
   1.11.1  Peroxidases
    1.11.1.9  glutathione peroxidase
     ACZ75_14400
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: GSHPx AhpC-TSA Redoxin DUF4174
Motif
Other DBs
NCBI-ProteinID: AKU22484
UniProt: A0A0K1JZF7
Position
3521091..3521576
Genome map
AA seq 161 aa AA seqDB search
MTTVFDFQAESLSGQKVDLAQYRGKVLLIVNTASKCGFTPQYEGLEALYRQFQERGVVVL
GFPCNQFLQQEPGTADDIAAFCTLNYGVSFPLFARIDVNGEHAHPLFQHLKKTAPGLLGT
EAIKWNFTKFLIRKDGSVYERYAPATKPAEILPDVEKLLAE
NT seq 486 nt NT seq  +upstreamnt  +downstreamnt
atgaccaccgtcttcgacttccaggccgagagcctgtccggccaaaaggtcgacctggcc
caataccgcggcaaggtgctgctgatcgtgaacacggccagcaaatgcggcttcacgccg
cagtacgagggcctggaagcgctctaccgccagttccaggaacgcggcgtggtggtgctg
ggcttcccctgcaaccagttcctgcagcaggagcccggcaccgccgacgatatcgccgcc
ttctgcaccttgaactatggcgtcagcttccccctgttcgcgcgcatcgacgtcaatggc
gaacatgcccatcccctgttccagcacctgaagaaaaccgcacccggcttgctcggcacg
gaagcgatcaaatggaacttcaccaaattcctgatccgcaaggatggcagcgtctatgag
cgctacgccccggccaccaagccggccgagattttgcccgatgtcgaaaagctgctcgct
gaataa

DBGET integrated database retrieval system