KEGG   Massilia sp. NR 4-1: ACZ75_19700Help
Entry
ACZ75_19700       CDS       T04026                                 

Definition
(GenBank) acetyl-CoA acetyltransferase
  KO
K00626  acetyl-CoA C-acetyltransferase [EC:2.3.1.9]
Organism
mnr  Massilia sp. NR 4-1
Pathway
mnr00071  Fatty acid degradation
mnr00072  Synthesis and degradation of ketone bodies
mnr00280  Valine, leucine and isoleucine degradation
mnr00310  Lysine degradation
mnr00362  Benzoate degradation
mnr00380  Tryptophan metabolism
mnr00620  Pyruvate metabolism
mnr00630  Glyoxylate and dicarboxylate metabolism
mnr00640  Propanoate metabolism
mnr00650  Butanoate metabolism
mnr00900  Terpenoid backbone biosynthesis
mnr01100  Metabolic pathways
mnr01110  Biosynthesis of secondary metabolites
mnr01120  Microbial metabolism in diverse environments
mnr01130  Biosynthesis of antibiotics
mnr01200  Carbon metabolism
mnr01212  Fatty acid metabolism
mnr02020  Two-component system
Brite
KEGG Orthology (KO) [BR:mnr00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00620 Pyruvate metabolism
    ACZ75_19700
   00630 Glyoxylate and dicarboxylate metabolism
    ACZ75_19700
   00640 Propanoate metabolism
    ACZ75_19700
   00650 Butanoate metabolism
    ACZ75_19700
  09103 Lipid metabolism
   00071 Fatty acid degradation
    ACZ75_19700
   00072 Synthesis and degradation of ketone bodies
    ACZ75_19700
  09105 Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    ACZ75_19700
   00310 Lysine degradation
    ACZ75_19700
   00380 Tryptophan metabolism
    ACZ75_19700
  09109 Metabolism of terpenoids and polyketides
   00900 Terpenoid backbone biosynthesis
    ACZ75_19700
  09111 Xenobiotics biodegradation and metabolism
   00362 Benzoate degradation
    ACZ75_19700
 09130 Environmental Information Processing
  09132 Signal transduction
   02020 Two-component system
    ACZ75_19700
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:mnr04147]
    ACZ75_19700
Enzymes [BR:mnr01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.9  acetyl-CoA C-acetyltransferase
     ACZ75_19700
Exosome [BR:mnr04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   ACZ75_19700
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Thiolase_N Thiolase_C ketoacyl-synt
Motif
Other DBs
NCBI-ProteinID: AKU23349
UniProt: A0A0K1K1X0
Position
complement(4715872..4717068)
Genome map
AA seq 398 aa AA seqDB search
MNDPIVIVGAARTPMGAFQGDFSSLSANELGAVAIKAAVERAGVKPEAVEHVYFGNCLMA
GQGQAPARQALIKAGLPTSTGAVTLSKMCGSAMQAAIFAHDTLAAGSAEVVVAGGMESMT
NAPYLIPKARGGYRIGHAMMFDHMMLDGLEDAYNRDEKGGGRSMGTFAEECATQYKFTRE
AQDAFAIESVKRAQAATADGSFAWEIAPVTVSSRAGDVVIDKDEGPGKAKLDKIPALKAA
FKKDGTITAASSSSINDGAAALVMMRESTAKKLGATVLAKVVGHATHAQAPNLFTTAPVG
AIQKLFAKNGWKASDVDLFEVNEAFAAVPMAAMHDLDIPHSKINIHGGACALGHPIGASG
ARIIITLLGALRKTGGKRGVAALCIGGGEATAVGIELA
NT seq 1197 nt NT seq  +upstreamnt  +downstreamnt
atgaatgatcctatcgttatcgtcggcgccgcgcgcaccccgatgggcgccttccagggc
gacttttccagcctgagcgccaatgagctgggcgccgtggcgatcaaggccgccgtcgag
cgcgccggcgtcaagccggaagccgtggaacacgtttatttcggcaactgcctgatggca
ggccagggccaggcgcccgcgcgccaagccctgatcaaggccggcttgccgacctcgacc
ggcgccgtgaccctgtccaagatgtgcggttcggccatgcaggcggccatcttcgcgcac
gacaccctggccgccggcagcgccgaggtggtggtggcgggcggcatggaatcgatgacc
aacgcgccctacctgatcccgaaagcgcgcggcggctaccgcatcggccacgccatgatg
ttcgaccacatgatgctggacggcctggaagatgcctacaaccgcgacgaaaaaggcggc
ggccgctcgatgggcaccttcgccgaagagtgcgccacccagtacaagttcacgcgcgaa
gcgcaggacgctttcgccatcgaatcggtcaagcgcgcccaggccgccacggccgacggc
agcttcgcctgggaaatcgccccggtgaccgtgtccagccgcgccggcgacgtggtgatc
gacaaggatgaaggtccgggcaaggccaagctggacaagatcccggccctgaaagccgcg
ttcaagaaagacggcacgatcaccgccgcttcctcgtcctcgatcaacgacggtgccgcc
gcgctggtgatgatgcgcgaatcgaccgccaagaaactcggcgcgaccgtgctggccaag
gtggtcggccacgccacccacgcccaggcgcccaacctgttcaccacggcgccggtgggc
gcgatccagaaactgttcgccaagaacggctggaaagccagcgacgtcgacctgttcgaa
gtgaacgaagcgttcgccgccgtgccgatggccgccatgcacgatctggacatcccgcac
agcaagatcaatatccacggcggcgcctgcgccctgggccacccgatcggcgcttccggc
gcgcgcatcatcatcaccctgctcggtgcgctgcgcaagaccggcggcaagcgcggcgtg
gccgccctgtgcatcggcggcggcgaagcgaccgcggtcggcatcgaactggcgtga

DBGET integrated database retrieval system