KEGG   Mycobacterium noviomagense: MNVI_02130
Entry
MNVI_02130        CDS       T06809                                 

Gene name
echA14
Definition
(GenBank) putative enoyl-CoA hydratase echA14
  KO
K01692  enoyl-CoA hydratase [EC:4.2.1.17]
Organism
mnv  Mycobacterium noviomagense
Pathway
mnv00071  Fatty acid degradation
mnv00280  Valine, leucine and isoleucine degradation
mnv00281  Geraniol degradation
mnv00310  Lysine degradation
mnv00360  Phenylalanine metabolism
mnv00362  Benzoate degradation
mnv00380  Tryptophan metabolism
mnv00410  beta-Alanine metabolism
mnv00627  Aminobenzoate degradation
mnv00640  Propanoate metabolism
mnv00650  Butanoate metabolism
mnv00903  Limonene and pinene degradation
mnv00930  Caprolactam degradation
mnv01100  Metabolic pathways
mnv01110  Biosynthesis of secondary metabolites
mnv01120  Microbial metabolism in diverse environments
mnv01212  Fatty acid metabolism
Module
mnv_M00087  beta-Oxidation
Brite
KEGG Orthology (KO) [BR:mnv00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00640 Propanoate metabolism
    MNVI_02130 (echA14)
   00650 Butanoate metabolism
    MNVI_02130 (echA14)
  09103 Lipid metabolism
   00071 Fatty acid degradation
    MNVI_02130 (echA14)
  09105 Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    MNVI_02130 (echA14)
   00310 Lysine degradation
    MNVI_02130 (echA14)
   00360 Phenylalanine metabolism
    MNVI_02130 (echA14)
   00380 Tryptophan metabolism
    MNVI_02130 (echA14)
  09106 Metabolism of other amino acids
   00410 beta-Alanine metabolism
    MNVI_02130 (echA14)
  09109 Metabolism of terpenoids and polyketides
   00903 Limonene and pinene degradation
    MNVI_02130 (echA14)
   00281 Geraniol degradation
    MNVI_02130 (echA14)
  09111 Xenobiotics biodegradation and metabolism
   00362 Benzoate degradation
    MNVI_02130 (echA14)
   00627 Aminobenzoate degradation
    MNVI_02130 (echA14)
   00930 Caprolactam degradation
    MNVI_02130 (echA14)
Enzymes [BR:mnv01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.17  enoyl-CoA hydratase
     MNVI_02130 (echA14)
SSDB
Motif
Pfam: ECH_1 ECH_2
Other DBs
NCBI-ProteinID: BBY04895
UniProt: A0A7I7P7V1
Position
266890..267648
AA seq 252 aa
MAQSDLVLYSVDNHIALITVNDPARRNAVTGAMSAQLRAAVERAQADTDVHAVVVTGAGK
AFCAGADLSALGEATEEGLLGVYDGFMAVANCTLPTIAAVNGAAVGAGLNLALAADVRIA
GPDALFDARFQKLGLHPGGGATWMLHRAVGPQVARAVLLFGMRFDAHAAVAHGLALSVVD
DPVAAALELAAGPAAAPRDVVLATKATMRATSSPGSLDTEQHELAKRAELGPQAQSIRSP
EFAARLAAARGK
NT seq 759 nt   +upstreamnt  +downstreamnt
atggcccagtccgatcttgtgctgtacagcgtcgacaaccacatcgcgcttatcacggtc
aacgaccccgcccggcgcaacgcggtcaccggggccatgtcggcgcagttgcgcgccgcc
gtggagcgggcccaggccgacaccgacgtgcacgccgtcgtggtcaccggtgccggcaag
gcgttttgcgcgggcgccgacctcagcgcgttgggcgaggccaccgaagaaggcttgctc
ggggtttatgacgggttcatggccgtcgccaactgcacgctgcccaccatcgccgcggtc
aacggtgccgcggtcggagcggggctgaacctcgcattggccgccgacgtgcgtatcgcc
ggaccggacgcgttgttcgacgcccgcttccagaaactcggcctgcatcccggtggcggc
gcaacctggatgctgcaccgggctgtcggaccccaagttgcccgtgccgtcctgttgttc
gggatgcgcttcgacgcccacgccgcggtcgcgcacgggctggcactgagtgtcgtcgac
gaccctgtcgctgccgcgctggaactggccgcgggaccagcagccgcgccacgcgacgtc
gtgcttgccaccaaggccaccatgcgcgccacctccagtccgggatcgctcgacaccgag
cagcacgaactggccaaacgcgccgagcttgggccgcaggcacagtcgattcgatcaccg
gaattcgccgcccggctggcggcggcgcggggtaagtag

KEGG   Mycobacterium noviomagense: MNVI_02630
Entry
MNVI_02630        CDS       T06809                                 

Definition
(GenBank) 3-hydroxypropionyl-CoA dehydratase
  KO
K01692  enoyl-CoA hydratase [EC:4.2.1.17]
Organism
mnv  Mycobacterium noviomagense
Pathway
mnv00071  Fatty acid degradation
mnv00280  Valine, leucine and isoleucine degradation
mnv00281  Geraniol degradation
mnv00310  Lysine degradation
mnv00360  Phenylalanine metabolism
mnv00362  Benzoate degradation
mnv00380  Tryptophan metabolism
mnv00410  beta-Alanine metabolism
mnv00627  Aminobenzoate degradation
mnv00640  Propanoate metabolism
mnv00650  Butanoate metabolism
mnv00903  Limonene and pinene degradation
mnv00930  Caprolactam degradation
mnv01100  Metabolic pathways
mnv01110  Biosynthesis of secondary metabolites
mnv01120  Microbial metabolism in diverse environments
mnv01212  Fatty acid metabolism
Module
mnv_M00087  beta-Oxidation
Brite
KEGG Orthology (KO) [BR:mnv00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00640 Propanoate metabolism
    MNVI_02630
   00650 Butanoate metabolism
    MNVI_02630
  09103 Lipid metabolism
   00071 Fatty acid degradation
    MNVI_02630
  09105 Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    MNVI_02630
   00310 Lysine degradation
    MNVI_02630
   00360 Phenylalanine metabolism
    MNVI_02630
   00380 Tryptophan metabolism
    MNVI_02630
  09106 Metabolism of other amino acids
   00410 beta-Alanine metabolism
    MNVI_02630
  09109 Metabolism of terpenoids and polyketides
   00903 Limonene and pinene degradation
    MNVI_02630
   00281 Geraniol degradation
    MNVI_02630
  09111 Xenobiotics biodegradation and metabolism
   00362 Benzoate degradation
    MNVI_02630
   00627 Aminobenzoate degradation
    MNVI_02630
   00930 Caprolactam degradation
    MNVI_02630
Enzymes [BR:mnv01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.17  enoyl-CoA hydratase
     MNVI_02630
SSDB
Motif
Pfam: ECH_1 ECH_2 Carboxyl_trans
Other DBs
NCBI-ProteinID: BBY04945
UniProt: A0A7I7P802
Position
328723..329589
AA seq 288 aa
MRLVSNRVTDMEQRDLNAVIYQHDPPIARIILNRPDKANTKDSTLVREVDECLHDADRDG
EIKVVILKANGNGFCGGHVARWGPDENPYPEFGSTFEELYKGTADLFLWPTLYLWEFPKP
TISQIHGYCMGGGIYLGLLTDFCVASEDAYFQMPLAQSLGEPGGHTMIEPWLMMNWHRVM
DWLLLAPTLSAQQALEWGLLNKVVPRDELEDTVEEMARRIAQIPLTTLMAVKNNVKRAWE
LMGMRVHLQVSHILTNMVGAASDVQARRAELLQSGLKPRDFVDRGDAP
NT seq 867 nt   +upstreamnt  +downstreamnt
ttgcgtctggtcagcaatagggtcaccgacatggagcagcgcgacctcaacgcggtcatc
taccaacacgatccgccgattgcgcggatcatcctcaaccggcctgacaaggccaacacc
aaggactcaacgctggtgcgggaagtcgacgagtgtctgcacgacgccgaccgcgacggc
gagatcaaagtcgtaatcctcaaggccaatggcaacggcttctgcggcgggcatgtagcc
cgctggggccccgacgagaacccgtacccggagttcggcagcaccttcgaggagctctac
aagggcaccgctgacctgtttttgtggccgacgttgtatctatgggagttccccaagccg
acgatctcccaaatccacggctactgcatgggcggcggcatctacctcggattgctgacc
gacttctgcgtcgcgtccgaggacgcgtatttccagatgccgcttgcccaaagcctcggc
gagccgggcggccacacgatgatcgagccgtggctgatgatgaactggcatcgggtcatg
gactggcttttgttggcgcccacgctgtcagctcagcaagcgctggagtggggcctgctc
aacaaggtggtgccgcgcgacgagcttgaggacaccgtcgaggagatggcgcgccggatc
gctcagattccgttgacgacgttgatggcggtgaagaacaacgtgaagcgggcctgggaa
ctgatggggatgcgcgtgcacttgcaagtcagccacatcttgaccaacatggtcggtgcg
gcatcggatgtgcaggcgcgtcgggccgagctgctgcagtcaggtttgaagccacgcgat
ttcgtcgaccggggcgacgctccttag

KEGG   Mycobacterium noviomagense: MNVI_02670
Entry
MNVI_02670        CDS       T06809                                 

Definition
(GenBank) enoyl-CoA hydratase
  KO
K01692  enoyl-CoA hydratase [EC:4.2.1.17]
Organism
mnv  Mycobacterium noviomagense
Pathway
mnv00071  Fatty acid degradation
mnv00280  Valine, leucine and isoleucine degradation
mnv00281  Geraniol degradation
mnv00310  Lysine degradation
mnv00360  Phenylalanine metabolism
mnv00362  Benzoate degradation
mnv00380  Tryptophan metabolism
mnv00410  beta-Alanine metabolism
mnv00627  Aminobenzoate degradation
mnv00640  Propanoate metabolism
mnv00650  Butanoate metabolism
mnv00903  Limonene and pinene degradation
mnv00930  Caprolactam degradation
mnv01100  Metabolic pathways
mnv01110  Biosynthesis of secondary metabolites
mnv01120  Microbial metabolism in diverse environments
mnv01212  Fatty acid metabolism
Module
mnv_M00087  beta-Oxidation
Brite
KEGG Orthology (KO) [BR:mnv00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00640 Propanoate metabolism
    MNVI_02670
   00650 Butanoate metabolism
    MNVI_02670
  09103 Lipid metabolism
   00071 Fatty acid degradation
    MNVI_02670
  09105 Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    MNVI_02670
   00310 Lysine degradation
    MNVI_02670
   00360 Phenylalanine metabolism
    MNVI_02670
   00380 Tryptophan metabolism
    MNVI_02670
  09106 Metabolism of other amino acids
   00410 beta-Alanine metabolism
    MNVI_02670
  09109 Metabolism of terpenoids and polyketides
   00903 Limonene and pinene degradation
    MNVI_02670
   00281 Geraniol degradation
    MNVI_02670
  09111 Xenobiotics biodegradation and metabolism
   00362 Benzoate degradation
    MNVI_02670
   00627 Aminobenzoate degradation
    MNVI_02670
   00930 Caprolactam degradation
    MNVI_02670
Enzymes [BR:mnv01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.17  enoyl-CoA hydratase
     MNVI_02670
SSDB
Motif
Pfam: ECH_1 ECH_2
Other DBs
NCBI-ProteinID: BBY04949
UniProt: A0A7I7P894
Position
complement(334257..335126)
AA seq 289 aa
MDLKETRERTIYEKQGAIARITLNWPEKANAQDQKLVEEMDAALADADRDYDVKVLIVKA
NGNGFCSGHAIGNNAVDYPEFVEGFKHTGTPWKPQTDLFVKPVLNLWEFSKPTIAQVHGY
CVGGGTHYGLTTDIVIASDDAYFQYPPLQGFGMPSGECSIEPWVFMNWRRAAYYLYLAEI
IDAQKALAIGLVNEVVPRDELESRVEAIARHIAQAPLTTLLATKANLKRAWELMGMRVHW
QSSNDLVALASLSADVQALVQQVLKGKIKPSEMARRQAAASEAAESAQA
NT seq 870 nt   +upstreamnt  +downstreamnt
atggatttgaaagagactcgcgagcgcacgatctacgaaaagcaaggcgccatcgcgcgt
atcacgctgaactggcccgaaaaggccaacgctcaagaccagaagcttgtcgaggagatg
gacgccgcgctggccgacgcggaccgcgactacgacgtcaaggtcctgatcgtcaaggcc
aacggcaacgggttctgctcgggacacgccatcggcaacaacgctgtcgactatccggaa
tttgtcgagggcttcaaacacaccggcacaccgtggaagccgcagaccgaccttttcgtc
aaaccggtgctgaacttgtgggagttctccaagccgacgatcgcgcaggtgcacggctac
tgcgtcggcggcggcacccattacgggctgacgaccgacatcgtcatcgcatcggacgac
gcctacttccagtacccaccgctgcagggtttcggcatgccgtccggcgaatgctccatc
gagccctgggttttcatgaactggcggcgagcggcctactacctttacctggcggagatc
atcgacgcccaaaaagcgctcgccatcggtctggtcaacgaggtggttccccgcgacgaa
ctcgaatcgcgtgtcgaggccatcgcccgtcacatcgcccaggctcccttgacgacactc
ttggcgacgaaggcaaacctcaagcgggcctgggagctgatgggcatgcgggtgcattgg
cagagctccaacgacctggtagcgcttgcgtcgctgagcgccgacgtgcaggccctggtg
cagcaggtactcaaaggcaagattaaaccctccgagatggcccgccgccaggcagcggcg
tcagaagcagcggaatccgcgcaggcgtaa

KEGG   Mycobacterium noviomagense: MNVI_02990
Entry
MNVI_02990        CDS       T06809                                 

Definition
(GenBank) enoyl-CoA hydratase
  KO
K01692  enoyl-CoA hydratase [EC:4.2.1.17]
Organism
mnv  Mycobacterium noviomagense
Pathway
mnv00071  Fatty acid degradation
mnv00280  Valine, leucine and isoleucine degradation
mnv00281  Geraniol degradation
mnv00310  Lysine degradation
mnv00360  Phenylalanine metabolism
mnv00362  Benzoate degradation
mnv00380  Tryptophan metabolism
mnv00410  beta-Alanine metabolism
mnv00627  Aminobenzoate degradation
mnv00640  Propanoate metabolism
mnv00650  Butanoate metabolism
mnv00903  Limonene and pinene degradation
mnv00930  Caprolactam degradation
mnv01100  Metabolic pathways
mnv01110  Biosynthesis of secondary metabolites
mnv01120  Microbial metabolism in diverse environments
mnv01212  Fatty acid metabolism
Module
mnv_M00087  beta-Oxidation
Brite
KEGG Orthology (KO) [BR:mnv00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00640 Propanoate metabolism
    MNVI_02990
   00650 Butanoate metabolism
    MNVI_02990
  09103 Lipid metabolism
   00071 Fatty acid degradation
    MNVI_02990
  09105 Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    MNVI_02990
   00310 Lysine degradation
    MNVI_02990
   00360 Phenylalanine metabolism
    MNVI_02990
   00380 Tryptophan metabolism
    MNVI_02990
  09106 Metabolism of other amino acids
   00410 beta-Alanine metabolism
    MNVI_02990
  09109 Metabolism of terpenoids and polyketides
   00903 Limonene and pinene degradation
    MNVI_02990
   00281 Geraniol degradation
    MNVI_02990
  09111 Xenobiotics biodegradation and metabolism
   00362 Benzoate degradation
    MNVI_02990
   00627 Aminobenzoate degradation
    MNVI_02990
   00930 Caprolactam degradation
    MNVI_02990
Enzymes [BR:mnv01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.17  enoyl-CoA hydratase
     MNVI_02990
SSDB
Motif
Pfam: ECH_1 ECH_2
Other DBs
NCBI-ProteinID: BBY04981
UniProt: A0A7I7P7W8
Position
complement(370459..371340)
AA seq 293 aa
MTASDDRVLFDVDTDKRIATITLNNLKHRNSYDASMRDAIARYLDRVAEDDDITVVLLRG
AGGVFSTGADMNNAYGWYGSDGGDKSTKSRSSQRRRLTVDRKSFGFYHNFMGFPKVTVGE
INGYALGGGFELALMTDISVIARDTKIGMPATRFLGPALGSLHMFFHRLGPVLARRLLLT
GDIIDAGTVEHLGIFTDTCDPGMVSARAWYWAEKAAKMPADGVVIAKEAFRLVEQTQAYQ
AEEVASYLFHAFGTNLQFAPGEFNFVKTRAQHGTKEAFRLRDEHFHVPEPEAP
NT seq 882 nt   +upstreamnt  +downstreamnt
atgacagcatcggacgatcgcgtgcttttcgacgtcgacaccgacaaacgaatcgccaca
atcacattgaacaacctgaagcaccgcaactcttacgacgcttcaatgcgtgacgccatc
gcgcgctacctggatcgcgtggccgaagacgacgacatcaccgtagtgctgctgcgcgga
gcgggcggagttttcagcaccggcgccgacatgaacaacgcctacggctggtacggctcg
gacggcggcgacaagtccaccaaaagccggtccagccaacgacgtcggctcaccgtagat
cgcaagtcgttcggtttctaccacaacttcatgggtttcccgaaagtcaccgtgggcgag
atcaatggttatgccttaggcggcgggttcgagctggcgctgatgaccgacatttccgta
atcgcccgcgacaccaagatcggcatgcccgcaacgcgtttcctcggtcccgcgctgggc
agcttgcacatgtttttccaccgactgggaccggttctggcgcggcgcctgctgttgacc
ggcgacatcatcgacgccggcacggtcgagcatctgggaatcttcaccgacacatgtgat
cccggcatggtgtcggcgcgcgcatggtactgggcggagaaggcggcgaaaatgccggcc
gacggcgtcgtgatcgccaaggaggcgttccgactggtcgaacagacccaggcctaccag
gcagaggaagtggcaagctacctgttccacgcgttcgggacgaatctgcaattcgcgccc
ggagaattcaactttgtgaagacacgagcacaacacggtacgaaggaggcgttccgcctg
cgcgacgaacacttccacgtgccagaacccgaagcgccgtga

KEGG   Mycobacterium noviomagense: MNVI_05630
Entry
MNVI_05630        CDS       T06809                                 

Gene name
echA10
Definition
(GenBank) enoyl-CoA hydratase
  KO
K01692  enoyl-CoA hydratase [EC:4.2.1.17]
Organism
mnv  Mycobacterium noviomagense
Pathway
mnv00071  Fatty acid degradation
mnv00280  Valine, leucine and isoleucine degradation
mnv00281  Geraniol degradation
mnv00310  Lysine degradation
mnv00360  Phenylalanine metabolism
mnv00362  Benzoate degradation
mnv00380  Tryptophan metabolism
mnv00410  beta-Alanine metabolism
mnv00627  Aminobenzoate degradation
mnv00640  Propanoate metabolism
mnv00650  Butanoate metabolism
mnv00903  Limonene and pinene degradation
mnv00930  Caprolactam degradation
mnv01100  Metabolic pathways
mnv01110  Biosynthesis of secondary metabolites
mnv01120  Microbial metabolism in diverse environments
mnv01212  Fatty acid metabolism
Module
mnv_M00087  beta-Oxidation
Brite
KEGG Orthology (KO) [BR:mnv00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00640 Propanoate metabolism
    MNVI_05630 (echA10)
   00650 Butanoate metabolism
    MNVI_05630 (echA10)
  09103 Lipid metabolism
   00071 Fatty acid degradation
    MNVI_05630 (echA10)
  09105 Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    MNVI_05630 (echA10)
   00310 Lysine degradation
    MNVI_05630 (echA10)
   00360 Phenylalanine metabolism
    MNVI_05630 (echA10)
   00380 Tryptophan metabolism
    MNVI_05630 (echA10)
  09106 Metabolism of other amino acids
   00410 beta-Alanine metabolism
    MNVI_05630 (echA10)
  09109 Metabolism of terpenoids and polyketides
   00903 Limonene and pinene degradation
    MNVI_05630 (echA10)
   00281 Geraniol degradation
    MNVI_05630 (echA10)
  09111 Xenobiotics biodegradation and metabolism
   00362 Benzoate degradation
    MNVI_05630 (echA10)
   00627 Aminobenzoate degradation
    MNVI_05630 (echA10)
   00930 Caprolactam degradation
    MNVI_05630 (echA10)
Enzymes [BR:mnv01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.17  enoyl-CoA hydratase
     MNVI_05630 (echA10)
SSDB
Motif
Pfam: ECH_1 ECH_2
Other DBs
NCBI-ProteinID: BBY05245
UniProt: A0A7I7P9K9
Position
655390..656208
AA seq 272 aa
MTAIESRIDTLAPVAGLSVTLTNGVLSVIIDRPESLNSVTTPVLAGIADAMEWAGADQRV
KVVRLGGAGRGFCSGAGMSADDVSGSGGPGTEIIAEANRAVRAITALPRPVVAVVHGPAA
GVGVSLALACDLVLASDTAFFMLAFTKVGLMPDGGASALVAAAIGRTRAMRMALLAERLP
AADALAAGLVSAVYPADQFDDEVDKVVSALAAGPGVAFAKTKEAINAATLTELDAALDRE
LQGQAVLLKSRDFIEGATAFQQRRTPNFTDTL
NT seq 819 nt   +upstreamnt  +downstreamnt
atgaccgcgatcgagtcccggatcgacaccctggcccccgtcgccggcctgtccgtcacg
cttaccaacggcgtgttgtcggtgatcatcgatcgcccggagagcctcaattcggtgacg
acgccggtgctggccgggatcgccgacgcgatggaatgggcgggcgccgatcagcgggtc
aaagtggtgcgcctcggcggagcgggtcgcggcttctgctccggagccggcatgagcgcc
gacgacgtgtccggcagcggcggtccgggcaccgaaatcatcgcggaggccaaccgcgcg
gtgcgggcgatcacagcgctgccgcggccggtggtcgctgtcgtgcacggccccgccgcc
ggtgtcggagtatccctggcgctggcctgtgaccttgtattggcttcggacacagcgttt
ttcatgcttgccttcaccaaggtgggcctgatgcccgacggtggcgcgtcggcgttggtc
gcagcagcaatcggccgtaccagggcgatgcgcatggcgctgttggcggagcgattgccg
gccgcagatgcgctggccgccggactggtgagcgccgtctatccggccgaccagttcgac
gacgaagtggacaaagtggtgtcggcgttagcggctgggcccggggtggcgttcgccaag
acaaaggaagccatcaacgcggctacgctcaccgaactcgacgcagcgctcgaccgcgaa
ttgcagggtcaggcggtgctgctgaaatcgcgtgacttcatcgagggggcaacggctttc
cagcagcgtcgcacacccaacttcaccgataccctctaa

KEGG   Mycobacterium noviomagense: MNVI_06490
Entry
MNVI_06490        CDS       T06809                                 

Definition
(GenBank) 3-hydroxyisobutyryl-CoA hydrolase
  KO
K01692  enoyl-CoA hydratase [EC:4.2.1.17]
Organism
mnv  Mycobacterium noviomagense
Pathway
mnv00071  Fatty acid degradation
mnv00280  Valine, leucine and isoleucine degradation
mnv00281  Geraniol degradation
mnv00310  Lysine degradation
mnv00360  Phenylalanine metabolism
mnv00362  Benzoate degradation
mnv00380  Tryptophan metabolism
mnv00410  beta-Alanine metabolism
mnv00627  Aminobenzoate degradation
mnv00640  Propanoate metabolism
mnv00650  Butanoate metabolism
mnv00903  Limonene and pinene degradation
mnv00930  Caprolactam degradation
mnv01100  Metabolic pathways
mnv01110  Biosynthesis of secondary metabolites
mnv01120  Microbial metabolism in diverse environments
mnv01212  Fatty acid metabolism
Module
mnv_M00087  beta-Oxidation
Brite
KEGG Orthology (KO) [BR:mnv00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00640 Propanoate metabolism
    MNVI_06490
   00650 Butanoate metabolism
    MNVI_06490
  09103 Lipid metabolism
   00071 Fatty acid degradation
    MNVI_06490
  09105 Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    MNVI_06490
   00310 Lysine degradation
    MNVI_06490
   00360 Phenylalanine metabolism
    MNVI_06490
   00380 Tryptophan metabolism
    MNVI_06490
  09106 Metabolism of other amino acids
   00410 beta-Alanine metabolism
    MNVI_06490
  09109 Metabolism of terpenoids and polyketides
   00903 Limonene and pinene degradation
    MNVI_06490
   00281 Geraniol degradation
    MNVI_06490
  09111 Xenobiotics biodegradation and metabolism
   00362 Benzoate degradation
    MNVI_06490
   00627 Aminobenzoate degradation
    MNVI_06490
   00930 Caprolactam degradation
    MNVI_06490
Enzymes [BR:mnv01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.17  enoyl-CoA hydratase
     MNVI_06490
SSDB
Motif
Pfam: ECH_2 ECH_1 Pullulanase_Ins
Other DBs
NCBI-ProteinID: BBY05331
UniProt: A0A7I7P9S6
Position
733601..734638
AA seq 345 aa
MTGESDEVLTRIDDGVAVVTLNRPKAINSLTQNMVNALSAVLTEWEHDDAVHAVVLDGAG
DRGLCAGGDVVAIYHSARADGVAARRFWRDEYLLDAQIARFPKPYVSLMDGIVMGGGVGV
GAHANTRLVTDTTKMAMPEVGIGFIPDVGGTYLLSRAPGSLGLHAALTGAPFSGADAIAM
GFADHYVPHDQMQAFTQAIITDNVDRALADHAVEPPASSLVAQRDWIDECYAGDTVADIV
AALRGHDSASANDAANLIGTRSPIALSVTLEAVRRAAKLDTLEDVLTQDYRVSCAALRSH
DLVEGIRAQLVDKDRNPKWSPASLAEVSAADVDAYFVPVDDDLKF
NT seq 1038 nt   +upstreamnt  +downstreamnt
gtgacgggcgaatcggacgaggtcctgacccgcatcgatgatggcgtcgccgttgtgaca
ctcaaccgccccaaggcgatcaactcgctgacccagaacatggtcaacgcgctcagcgca
gttctcaccgaatgggaacacgacgacgccgtgcacgcggtggttctcgacggggccggc
gaccgcggactgtgcgccggcggcgacgtcgtggcgatctaccacagcgcacgcgcggac
ggtgttgcggcgcggcgcttctggcgcgacgaatacctgctcgacgcgcaaatcgccagg
tttcccaaaccgtacgtgtcgttgatggatggcattgtgatgggcggcggtgtgggtgtc
ggcgcgcatgccaacacccggctggtgaccgatacgacgaagatggcgatgcccgaggtg
ggcatcgggttcatccccgacgtcggcggtacgtatctgctctcgcgggctcctgggtcg
ctgggcctgcacgcggcactgaccggggcgccgttctccggcgccgacgccattgcaatg
ggattcgccgaccactacgtgccgcacgaccagatgcaagcattcacacaggcgatcatc
accgacaacgtcgaccgcgcgctcgccgaccacgccgtcgaaccgcccgccagcagcctt
gtggcccaacgggattggatcgacgagtgttacgcgggcgacactgttgccgacatcgtc
gccgcgctgcgcggtcatgactccgcttcggcaaacgacgcggccaacctgatcggcacc
cgctcgcccatcgcgttgtcggtgacactcgaggcggtgcgccgcgccgccaagctcgac
acgctggaagacgtcctgacccaggactaccgggtgtcatgcgccgccctgcgctcacac
gacctggtcgaaggtatccgcgcccagctggtggacaaggaccgcaatccgaagtggtcg
ccggcgtcgcttgccgaggtcagcgcggccgatgttgacgcgtatttcgtgcccgtcgac
gacgacctgaagttctag

KEGG   Mycobacterium noviomagense: MNVI_06500
Entry
MNVI_06500        CDS       T06809                                 

Gene name
echA8
Definition
(GenBank) putative enoyl-CoA hydratase echA8
  KO
K01692  enoyl-CoA hydratase [EC:4.2.1.17]
Organism
mnv  Mycobacterium noviomagense
Pathway
mnv00071  Fatty acid degradation
mnv00280  Valine, leucine and isoleucine degradation
mnv00281  Geraniol degradation
mnv00310  Lysine degradation
mnv00360  Phenylalanine metabolism
mnv00362  Benzoate degradation
mnv00380  Tryptophan metabolism
mnv00410  beta-Alanine metabolism
mnv00627  Aminobenzoate degradation
mnv00640  Propanoate metabolism
mnv00650  Butanoate metabolism
mnv00903  Limonene and pinene degradation
mnv00930  Caprolactam degradation
mnv01100  Metabolic pathways
mnv01110  Biosynthesis of secondary metabolites
mnv01120  Microbial metabolism in diverse environments
mnv01212  Fatty acid metabolism
Module
mnv_M00087  beta-Oxidation
Brite
KEGG Orthology (KO) [BR:mnv00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00640 Propanoate metabolism
    MNVI_06500 (echA8)
   00650 Butanoate metabolism
    MNVI_06500 (echA8)
  09103 Lipid metabolism
   00071 Fatty acid degradation
    MNVI_06500 (echA8)
  09105 Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    MNVI_06500 (echA8)
   00310 Lysine degradation
    MNVI_06500 (echA8)
   00360 Phenylalanine metabolism
    MNVI_06500 (echA8)
   00380 Tryptophan metabolism
    MNVI_06500 (echA8)
  09106 Metabolism of other amino acids
   00410 beta-Alanine metabolism
    MNVI_06500 (echA8)
  09109 Metabolism of terpenoids and polyketides
   00903 Limonene and pinene degradation
    MNVI_06500 (echA8)
   00281 Geraniol degradation
    MNVI_06500 (echA8)
  09111 Xenobiotics biodegradation and metabolism
   00362 Benzoate degradation
    MNVI_06500 (echA8)
   00627 Aminobenzoate degradation
    MNVI_06500 (echA8)
   00930 Caprolactam degradation
    MNVI_06500 (echA8)
Enzymes [BR:mnv01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.17  enoyl-CoA hydratase
     MNVI_06500 (echA8)
SSDB
Motif
Pfam: ECH_1 ECH_2 DUF218 DUF6403
Other DBs
NCBI-ProteinID: BBY05332
UniProt: A0A7I7P9U1
Position
734650..735429
AA seq 259 aa
MIDKWETILVERDGRVGTITLNRPQALNALNSQMMNEVTSAATEFDSNRGIGAIIITGSA
KAFAAGADIKEMANLTFADVFSADYFAPWSKLAAVRTPTIAAVAGHALGGGCELAMMCDV
LIAADTAKFGQPEIKLGVLPGMGGSQRLTRAIGKAKAMDLILTGRTIDAAEAERSGLVSR
VVPADDLLTEAKAVASTIAGMSLSATRMAKEAVNRAFESTLAEGLLYERRLFHSAFATDD
QSEGMAAFIEKRPPNFTHR
NT seq 780 nt   +upstreamnt  +downstreamnt
atgatcgacaaatgggaaaccatcctggtcgaacgcgacggacgcgtcggcaccatcacg
ctgaaccggccgcaggcgctcaacgcgctcaacagccagatgatgaacgaagtcacaagc
gctgcaacagaattcgatagcaaccgaggtatcggcgcgatcatcatcaccggttcggca
aaagcgttcgccgccggtgcggacatcaaggaaatggccaacctgacgttcgccgacgtc
ttcagcgccgactatttcgctccctggtcgaagctggccgcggtacgtaccccgacgatc
gccgcagtggccgggcacgcgctcggcggcgggtgcgagctggcgatgatgtgcgacgtg
ctgattgcggccgacacagcgaaattcggccagccggagatcaaactcggcgtattgccc
ggcatgggcggctcgcagcggctgacgcgggccatcggcaaggccaaggctatggatctc
atcctgaccgggcgcaccatcgacgccgccgaagccgagcgcagcggcctcgtctcacgc
gtggtccccgccgacgacctgctcaccgaggctaaagctgtggccagcaccatcgctgga
atgtcgctgtcagcgacccggatggccaaggaagccgtcaaccgcgcgttcgaatccacc
ctggccgaagggcttctctacgaacgtcggctatttcattcggctttcgccaccgacgac
cagtcggaaggcatggcggcgttcatcgagaaacgcccgccgaacttcacgcaccggtag

KEGG   Mycobacterium noviomagense: MNVI_07820
Entry
MNVI_07820        CDS       T06809                                 

Gene name
echA7
Definition
(GenBank) enoyl-CoA hydratase
  KO
K01692  enoyl-CoA hydratase [EC:4.2.1.17]
Organism
mnv  Mycobacterium noviomagense
Pathway
mnv00071  Fatty acid degradation
mnv00280  Valine, leucine and isoleucine degradation
mnv00281  Geraniol degradation
mnv00310  Lysine degradation
mnv00360  Phenylalanine metabolism
mnv00362  Benzoate degradation
mnv00380  Tryptophan metabolism
mnv00410  beta-Alanine metabolism
mnv00627  Aminobenzoate degradation
mnv00640  Propanoate metabolism
mnv00650  Butanoate metabolism
mnv00903  Limonene and pinene degradation
mnv00930  Caprolactam degradation
mnv01100  Metabolic pathways
mnv01110  Biosynthesis of secondary metabolites
mnv01120  Microbial metabolism in diverse environments
mnv01212  Fatty acid metabolism
Module
mnv_M00087  beta-Oxidation
Brite
KEGG Orthology (KO) [BR:mnv00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00640 Propanoate metabolism
    MNVI_07820 (echA7)
   00650 Butanoate metabolism
    MNVI_07820 (echA7)
  09103 Lipid metabolism
   00071 Fatty acid degradation
    MNVI_07820 (echA7)
  09105 Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    MNVI_07820 (echA7)
   00310 Lysine degradation
    MNVI_07820 (echA7)
   00360 Phenylalanine metabolism
    MNVI_07820 (echA7)
   00380 Tryptophan metabolism
    MNVI_07820 (echA7)
  09106 Metabolism of other amino acids
   00410 beta-Alanine metabolism
    MNVI_07820 (echA7)
  09109 Metabolism of terpenoids and polyketides
   00903 Limonene and pinene degradation
    MNVI_07820 (echA7)
   00281 Geraniol degradation
    MNVI_07820 (echA7)
  09111 Xenobiotics biodegradation and metabolism
   00362 Benzoate degradation
    MNVI_07820 (echA7)
   00627 Aminobenzoate degradation
    MNVI_07820 (echA7)
   00930 Caprolactam degradation
    MNVI_07820 (echA7)
Enzymes [BR:mnv01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.17  enoyl-CoA hydratase
     MNVI_07820 (echA7)
SSDB
Motif
Pfam: ECH_1 ECH_2 PE
Other DBs
NCBI-ProteinID: BBY05464
UniProt: A0A7I7PA69
Position
866261..867049
AA seq 262 aa
MDTLVRYAVDGHVARLTLDSPHNRNALSSTLVSQLHHGLRDAAADPRVRVVVLGHTSGTF
CAGADLSEASGGDPFEMAAERARELAALLRAIVDLPLPVIGAITGHVRAGGFGLVGACDI
AVAGPHSSFALTEARIGVAPAIISLTLLPKMSARAAARYYLTGEKFDADEAAAIGLITMA
ADDVDAAVAALVAEVGRGSPQGLAASKALTTAAVLEGFDRDAERLSVESARLFVTDEARE
GMMAFLQKRPPRWVALSAGDAV
NT seq 789 nt   +upstreamnt  +downstreamnt
atggacacactcgttcggtatgccgtcgacggacatgttgcgcggctgacgctcgactca
ccgcataaccgcaacgcgctttccagcacactggtcagccaactgcaccacgggctgcgc
gacgcggccgccgatccgcgggtgcgcgtggtggtgctcggccacactagcggcaccttc
tgcgcgggcgcggatctatcggaagccagcgggggcgacccgttcgagatggccgccgag
cgcgcccgggaattggcggcgctgctgcgcgcgatcgtcgacttgccgctgccggtgatc
ggcgccatcaccggccacgtccgcgccggggggttcggcttggtcggtgcctgcgatatc
gcagtggccggcccgcacagcagcttcgccctgaccgaagcacgcatcggagtggcaccg
gccatcatttcgctcaccctgctgccgaagatgtccgcccgggcggcagcgcgttactac
ctgaccggggagaaattcgacgcggacgaagcggcggctatcgggttgatcaccatggca
gctgacgacgtcgacgccgcggtggcagcgcttgttgcggaagtgggacgcgggtcaccg
cagggattggcggcatcgaaagcactgaccaccgccgcggtgctggagggatttgaccgc
gacgccgagcggctcagcgtcgagtcggcgcggttgttcgtcaccgacgaagctcgcgag
ggaatgatggccttcctgcagaaacgcccgccgcgatgggtcgctctaagtgctggcgac
gcagtttag

KEGG   Mycobacterium noviomagense: MNVI_08450
Entry
MNVI_08450        CDS       T06809                                 

Gene name
echA6
Definition
(GenBank) putative enoyl-CoA hydratase echA6
  KO
K01692  enoyl-CoA hydratase [EC:4.2.1.17]
Organism
mnv  Mycobacterium noviomagense
Pathway
mnv00071  Fatty acid degradation
mnv00280  Valine, leucine and isoleucine degradation
mnv00281  Geraniol degradation
mnv00310  Lysine degradation
mnv00360  Phenylalanine metabolism
mnv00362  Benzoate degradation
mnv00380  Tryptophan metabolism
mnv00410  beta-Alanine metabolism
mnv00627  Aminobenzoate degradation
mnv00640  Propanoate metabolism
mnv00650  Butanoate metabolism
mnv00903  Limonene and pinene degradation
mnv00930  Caprolactam degradation
mnv01100  Metabolic pathways
mnv01110  Biosynthesis of secondary metabolites
mnv01120  Microbial metabolism in diverse environments
mnv01212  Fatty acid metabolism
Module
mnv_M00087  beta-Oxidation
Brite
KEGG Orthology (KO) [BR:mnv00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00640 Propanoate metabolism
    MNVI_08450 (echA6)
   00650 Butanoate metabolism
    MNVI_08450 (echA6)
  09103 Lipid metabolism
   00071 Fatty acid degradation
    MNVI_08450 (echA6)
  09105 Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    MNVI_08450 (echA6)
   00310 Lysine degradation
    MNVI_08450 (echA6)
   00360 Phenylalanine metabolism
    MNVI_08450 (echA6)
   00380 Tryptophan metabolism
    MNVI_08450 (echA6)
  09106 Metabolism of other amino acids
   00410 beta-Alanine metabolism
    MNVI_08450 (echA6)
  09109 Metabolism of terpenoids and polyketides
   00903 Limonene and pinene degradation
    MNVI_08450 (echA6)
   00281 Geraniol degradation
    MNVI_08450 (echA6)
  09111 Xenobiotics biodegradation and metabolism
   00362 Benzoate degradation
    MNVI_08450 (echA6)
   00627 Aminobenzoate degradation
    MNVI_08450 (echA6)
   00930 Caprolactam degradation
    MNVI_08450 (echA6)
Enzymes [BR:mnv01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.17  enoyl-CoA hydratase
     MNVI_08450 (echA6)
SSDB
Motif
Pfam: ECH_1 ECH_2
Other DBs
NCBI-ProteinID: BBY05527
UniProt: A0A7I7PAB0
Position
complement(931604..932335)
AA seq 243 aa
MIGVTRVEAVTTIELQRAERRNALNSELVEELREAVEKAAAENVRAIVLTGQGTVFCAGA
DLSGDAFAADYPDRLIALHKAMDAAPMPVIGAINGPAIGAGLQLAMQCDLRVVAPDAFFQ
FPTSKYGLALDNWSIRRLCSLVGHGRARAMLLAAEKLPADVALATGMANRIGTVADAQAW
AAEIAGLAPLALQHAKRVLNDDGAIEEASPVHKELFDKAWASQDAIEAQVARIQKRPPNF
QGA
NT seq 732 nt   +upstreamnt  +downstreamnt
atgatcggtgtcacccgcgtcgaagccgtcaccaccattgagctgcagcgtgctgagcgg
cgaaacgccctgaactccgagctggtcgaggagctgcgcgaagccgtggaaaaagcggcg
gccgaaaatgtgcgcgcgatcgtgctgaccggtcagggcaccgtgttctgcgctggcgca
gacctgagcggagacgcgttcgccgccgactatccggaccggctcatcgcgttgcacaaa
gcgatggatgccgcgccgatgccggtgatcggcgccatcaacggaccggccatcggcgcc
ggcttgcagctggcgatgcagtgcgatctgcgggtcgttgccccagacgcgttcttccag
ttccccacctcgaaatacggcctggcacttgataactggagcatccgtcggctgtgctcg
ctggtaggtcacggccgcgcgcgggcgatgctgctggccgccgagaagctgccggccgac
gtggcgctggccaccggcatggccaaccggatcggcacggtggccgatgcgcaggcctgg
gcggcggagatcgccgggctggcgcctctggcgctgcagcacgccaagcgagtgctcaac
gacgacggcgccatcgaggaagcgtcgccggtccacaaggagctgttcgataaggcgtgg
gccagccaggacgcgatcgaggcccaggtcgctcgcatacagaaacggccaccgaacttc
cagggagcctga

KEGG   Mycobacterium noviomagense: MNVI_08950
Entry
MNVI_08950        CDS       T06809                                 

Gene name
fadB
Definition
(GenBank) fatty oxidation protein FadB
  KO
K01782  3-hydroxyacyl-CoA dehydrogenase / enoyl-CoA hydratase / 3-hydroxybutyryl-CoA epimerase [EC:1.1.1.35 4.2.1.17 5.1.2.3]
Organism
mnv  Mycobacterium noviomagense
Pathway
mnv00071  Fatty acid degradation
mnv00280  Valine, leucine and isoleucine degradation
mnv00281  Geraniol degradation
mnv00310  Lysine degradation
mnv00362  Benzoate degradation
mnv00380  Tryptophan metabolism
mnv00410  beta-Alanine metabolism
mnv00640  Propanoate metabolism
mnv00650  Butanoate metabolism
mnv00903  Limonene and pinene degradation
mnv00930  Caprolactam degradation
mnv01100  Metabolic pathways
mnv01110  Biosynthesis of secondary metabolites
mnv01120  Microbial metabolism in diverse environments
mnv01200  Carbon metabolism
mnv01212  Fatty acid metabolism
Module
mnv_M00087  beta-Oxidation
Brite
KEGG Orthology (KO) [BR:mnv00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00640 Propanoate metabolism
    MNVI_08950 (fadB)
   00650 Butanoate metabolism
    MNVI_08950 (fadB)
  09103 Lipid metabolism
   00071 Fatty acid degradation
    MNVI_08950 (fadB)
  09105 Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    MNVI_08950 (fadB)
   00310 Lysine degradation
    MNVI_08950 (fadB)
   00380 Tryptophan metabolism
    MNVI_08950 (fadB)
  09106 Metabolism of other amino acids
   00410 beta-Alanine metabolism
    MNVI_08950 (fadB)
  09109 Metabolism of terpenoids and polyketides
   00903 Limonene and pinene degradation
    MNVI_08950 (fadB)
   00281 Geraniol degradation
    MNVI_08950 (fadB)
  09111 Xenobiotics biodegradation and metabolism
   00362 Benzoate degradation
    MNVI_08950 (fadB)
   00930 Caprolactam degradation
    MNVI_08950 (fadB)
Enzymes [BR:mnv01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.35  3-hydroxyacyl-CoA dehydrogenase
     MNVI_08950 (fadB)
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.17  enoyl-CoA hydratase
     MNVI_08950 (fadB)
 5. Isomerases
  5.1  Racemases and epimerases
   5.1.2  Acting on hydroxy acids and derivatives
    5.1.2.3  3-hydroxybutyryl-CoA epimerase
     MNVI_08950 (fadB)
SSDB
Motif
Pfam: 3HCDH_N ECH_1 ECH_2 3HCDH NAD_Gly3P_dh_N NAD_binding_2 F420_oxidored DAO AlaDh_PNT_C 2-Hacid_dh_C NAD_binding_8 adh_short_C2 UDPG_MGDP_dh_N Sacchrp_dh_NADP Shikimate_DH
Other DBs
NCBI-ProteinID: BBY05577
UniProt: A0A7I7PAG0
Position
complement(975932..978067)
AA seq 711 aa
MADNTIQWDKDADGIVTLTMDDPSGSANVMNEAYIESMGKAVDRLVAEKDSITGVVITSA
KKTFFAGGDLTAMVQAKPEDAGQFFDTVERVKKQLRTLETFGKPVVAAINGAALGGGLEI
ALACHHRIAADVPGSQIGVPEVTLGLLPGGGGVTRTVRMFGIQKAFVEILAQGTRFKPAK
AKEIGLVDEVLPSVEELVPAAKAWIKANPDAHVQPWDKQGYKMPGGTPASPSLAAILPSF
PSNLRKQLKGAPMPAPRAILAAAVEGAQVDFDTASRIESRYFTSLVTSQVAKNMIQAFFF
DLQHINSGGSRPDGYEKTTFKKVAVLGAGMMGAAIAYVCAKAGIEVILKDVTLEAAQRGK
EYSEKLEAKALQRGRTTQERSDALLGRIHPTADPNDAAGADLVIEAVFESVELKHKVFGE
IEPVVAPDAVLGSNTSTLPITELATGVKRAEDFIGLHFFSPVDKMPLLEIIKGEKTSDAT
LAKAVDLAMQIGKTPIVVNDSRGFYTSRVIGTFINEAIAMLGEGVEPASIEHAGNQAGYP
APPLQLSDELNMELMAKIAKATREGVESAGQTYTPHPAEAVVNKMLELGRPGKLKGAGFY
EYVEGKRAGLWPGLREAFNSGSSQPPLQDMIDRMLFVEALETQKCLDEGVLTSTADANIG
SIMGIGFPPWTGGTAQFVVGYPGGKAGFVARARELAAKYGDRFLPPDSLTS
NT seq 2136 nt   +upstreamnt  +downstreamnt
atggcagacaacacgattcagtgggacaaggacgccgacggcatcgtcacgttgaccatg
gacgacccgtccgggtcggccaacgtgatgaacgaggcctacatcgagtcgatgggcaag
gcggtggatcgcctcgtcgccgagaaggattcaatcaccggtgtggtgatcaccagcgcg
aagaagaccttcttcgccggcggggacctgaccgcgatggttcaggcgaagccggaggac
gccgggcagttcttcgacaccgtggagcgggtcaagaagcagctgcgcacgctggagacg
ttcggcaagcccgtcgtcgcggccatcaacggggccgcactcggcggtggcctggagatc
gcgctggcgtgtcaccaccggatcgccgccgacgtcccgggtagccagatcggtgtgcct
gaggtgacgctcggcttgcttcccggtggtggcggcgtgacgcgcaccgtgcggatgttc
ggcatccagaaggcgttcgtggagatcctggcgcagggcacccggttcaagccggccaag
gccaaggagatcggtctggtcgacgaggtgctgccgagcgtcgaggagctggtgcctgcg
gccaaggcctggatcaaagccaacccggacgcgcatgtgcagccgtgggacaagcagggt
tacaagatgcctggcggcaccccggcgtcgccttcactggcggcgatcctgccgtcgttc
ccgtcaaacctgcgcaagcagctcaagggtgcgccgatgccggcgccgcgcgcgatcctg
gccgccgcggtcgagggcgcgcaggtcgacttcgacaccgcaagccgcatcgaaagccgg
tatttcacgtcgctggtcacgtcgcaggtagccaagaacatgatccaggcgttcttcttc
gacctacagcacatcaactccggtggctcgcggcccgatggctacgagaagaccacgttc
aaaaaagttgcggtgctcggtgccgggatgatgggcgcggccatcgcctacgtgtgcgcc
aaggccggcatcgaggtgatcctcaaagacgtgaccttggaagctgcgcagaggggcaag
gaatactccgaaaagctggaagccaaggcgttgcagcggggcaggaccacccaggagcgc
tccgacgccctgctgggccgcatccatccgaccgctgacccgaacgatgccgccggcgcc
gatctggtgatcgaggcggtgttcgagtcggttgagttgaagcacaaggtgttcggtgag
atcgagccggtggtggcgcccgacgcggtgctgggctccaacacctccaccttgcctatt
acggagctggccaccggagtcaagcgggccgaggacttcatcggcctgcacttcttctcg
ccggtcgacaagatgccgctgctggaaatcatcaagggcgagaagacgtctgacgccacc
ctggcgaaggctgtggatctggcgatgcagatcggcaagacgccgatcgtggtcaacgac
agccgcggcttctacacgtcgcgtgtgatcggcacgttcatcaacgaggcgatcgccatg
ctcggcgagggtgtcgagccggccagcatcgaacacgccggcaaccaggccggctatccc
gcgccgccgctgcagctgtccgacgagctcaacatggagctgatggccaagatcgccaag
gccactcgcgaaggcgtggaaagtgcggggcagacctacacgccgcacccggccgaggcc
gtcgtcaacaagatgctcgagctgggccggcccgggaagctcaagggtgccgggttttac
gagtacgtcgaaggcaagcgggccggcctgtggccgggactgcgggaggcgttcaactcc
ggctcgtcgcagcctccgttacaggacatgatcgaccgaatgctgttcgtcgaggcgctg
gaaacccagaagtgtcttgacgagggcgtgctgacttccacagcggacgccaacatcgga
tcgatcatggggatcggtttcccgccgtggaccgggggcaccgcgcagttcgtcgtcggc
taccccgggggcaaggcgggcttcgtcgcccgggcccgcgagttggccgccaagtacggt
gaccggttcctgccgccggactcgctgacctcttag

KEGG   Mycobacterium noviomagense: MNVI_10300
Entry
MNVI_10300        CDS       T06809                                 

Definition
(GenBank) enoyl-CoA hydratase
  KO
K01692  enoyl-CoA hydratase [EC:4.2.1.17]
Organism
mnv  Mycobacterium noviomagense
Pathway
mnv00071  Fatty acid degradation
mnv00280  Valine, leucine and isoleucine degradation
mnv00281  Geraniol degradation
mnv00310  Lysine degradation
mnv00360  Phenylalanine metabolism
mnv00362  Benzoate degradation
mnv00380  Tryptophan metabolism
mnv00410  beta-Alanine metabolism
mnv00627  Aminobenzoate degradation
mnv00640  Propanoate metabolism
mnv00650  Butanoate metabolism
mnv00903  Limonene and pinene degradation
mnv00930  Caprolactam degradation
mnv01100  Metabolic pathways
mnv01110  Biosynthesis of secondary metabolites
mnv01120  Microbial metabolism in diverse environments
mnv01212  Fatty acid metabolism
Module
mnv_M00087  beta-Oxidation
Brite
KEGG Orthology (KO) [BR:mnv00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00640 Propanoate metabolism
    MNVI_10300
   00650 Butanoate metabolism
    MNVI_10300
  09103 Lipid metabolism
   00071 Fatty acid degradation
    MNVI_10300
  09105 Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    MNVI_10300
   00310 Lysine degradation
    MNVI_10300
   00360 Phenylalanine metabolism
    MNVI_10300
   00380 Tryptophan metabolism
    MNVI_10300
  09106 Metabolism of other amino acids
   00410 beta-Alanine metabolism
    MNVI_10300
  09109 Metabolism of terpenoids and polyketides
   00903 Limonene and pinene degradation
    MNVI_10300
   00281 Geraniol degradation
    MNVI_10300
  09111 Xenobiotics biodegradation and metabolism
   00362 Benzoate degradation
    MNVI_10300
   00627 Aminobenzoate degradation
    MNVI_10300
   00930 Caprolactam degradation
    MNVI_10300
Enzymes [BR:mnv01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.17  enoyl-CoA hydratase
     MNVI_10300
SSDB
Motif
Pfam: ECH_1 ECH_2
Other DBs
NCBI-ProteinID: BBY05712
UniProt: A0A7I7PAX0
Position
complement(1101881..1102648)
AA seq 255 aa
MYDMPEEIDVQADGPLRIITLNRPDALNAVNDSLHTGLAQLWPRLSDDRTARAAVLTGSG
RAFSAGGDFHYLAELAQDAGLRAKTIAHGREIVLGMARCRIPVVAAVNGPAVGLGCSLVA
LSDIVYIAEEAYLADPHVQVGLVAADGGPITWPLHISLLLAKEYALTGARIPAARAVELG
LANHVVADPMAEAVAAAKRTMELPQQAVESTKRVLNVHLERAVLATLDFALTAENQSFQT
EDFRSIVTKLTAGKN
NT seq 768 nt   +upstreamnt  +downstreamnt
gtgtacgacatgccggaggaaatcgacgtccaagcagacgggccgctgcgcatcatcaca
ctgaaccgcccggatgcgctcaacgcggtcaatgacagcctgcacaccgggctggcgcag
ctgtggccgcggctcagcgacgaccgcaccgctcgcgccgcggtgcttaccggcagcggc
cgcgcgttctcggcgggcggcgactttcactacctggccgagctggcccaggacgccggt
ctgcgcgccaaaaccattgcccacggccgcgagatcgtgctgggcatggcccgctgccga
attccggtggtggcggccgtcaatgggccggccgtggggttgggttgcagcctggtggcg
ctcagcgacatcgtctacatcgccgaggaggcctatctcgccgatccgcacgtgcaggtg
gggctggtcgccgccgatggtggaccgattacctggccgctgcacatcagtcttctgctg
gccaaggaatacgccttgaccggtgcgcggattcccgcggcgcgggccgtggaactcggg
ctggccaaccatgtcgtcgccgatccaatggccgaggcggttgccgcagccaagcggacg
atggaactgccccaacaggccgtcgagagcaccaagcgggtgctcaacgtgcacctcgaa
cgcgcggtgttggccacgctcgacttcgccctgaccgccgagaatcagtccttccagacc
gaggacttccgctcgatcgtcaccaagctgaccgccggcaagaactga

KEGG   Mycobacterium noviomagense: MNVI_11650
Entry
MNVI_11650        CDS       T06809                                 

Definition
(GenBank) enoyl-CoA hydratase
  KO
K01692  enoyl-CoA hydratase [EC:4.2.1.17]
Organism
mnv  Mycobacterium noviomagense
Pathway
mnv00071  Fatty acid degradation
mnv00280  Valine, leucine and isoleucine degradation
mnv00281  Geraniol degradation
mnv00310  Lysine degradation
mnv00360  Phenylalanine metabolism
mnv00362  Benzoate degradation
mnv00380  Tryptophan metabolism
mnv00410  beta-Alanine metabolism
mnv00627  Aminobenzoate degradation
mnv00640  Propanoate metabolism
mnv00650  Butanoate metabolism
mnv00903  Limonene and pinene degradation
mnv00930  Caprolactam degradation
mnv01100  Metabolic pathways
mnv01110  Biosynthesis of secondary metabolites
mnv01120  Microbial metabolism in diverse environments
mnv01212  Fatty acid metabolism
Module
mnv_M00087  beta-Oxidation
Brite
KEGG Orthology (KO) [BR:mnv00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00640 Propanoate metabolism
    MNVI_11650
   00650 Butanoate metabolism
    MNVI_11650
  09103 Lipid metabolism
   00071 Fatty acid degradation
    MNVI_11650
  09105 Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    MNVI_11650
   00310 Lysine degradation
    MNVI_11650
   00360 Phenylalanine metabolism
    MNVI_11650
   00380 Tryptophan metabolism
    MNVI_11650
  09106 Metabolism of other amino acids
   00410 beta-Alanine metabolism
    MNVI_11650
  09109 Metabolism of terpenoids and polyketides
   00903 Limonene and pinene degradation
    MNVI_11650
   00281 Geraniol degradation
    MNVI_11650
  09111 Xenobiotics biodegradation and metabolism
   00362 Benzoate degradation
    MNVI_11650
   00627 Aminobenzoate degradation
    MNVI_11650
   00930 Caprolactam degradation
    MNVI_11650
Enzymes [BR:mnv01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.17  enoyl-CoA hydratase
     MNVI_11650
SSDB
Motif
Pfam: ECH_1 ECH_2
Other DBs
NCBI-ProteinID: BBY05847
UniProt: A0A7I7PB66
Position
complement(1233247..1234182)
AA seq 311 aa
MAVHDDVGTGAVNSESAELVTYETLDEGRIARVWLNRPEAHNAQNRTLLVQLDEAFLRAE
ADDEVRVVILAARGRNFSAGHDLGSEAALAERKPGPAQHPTFRGYGATRDPIAEKTFLQE
WHFYFQNTCRWRDLRKITIAQVQGNAISAGLMLIWACDLIVAADNAKFSDVVGVRMGMPG
VEYYAHPWEFGPRKAKELLLTGDSLDADEAYRLGMVSKVFPLDQLEEKTLEFARRIAERP
TMAALLIKDSVNAASDAMGFTEALRHAFHVHELGHAHWAARNENRYPVGLPPDVEDWRNA
KPSKIARRDEP
NT seq 936 nt   +upstreamnt  +downstreamnt
atggcagtccacgacgatgtgggcaccggcgcggtcaacagtgaatccgctgagctggtg
acctacgagacgctcgacgagggccgcatcgcccgggtctggctcaaccggcccgaggcg
cacaacgcccagaaccgcaccctgctggtccagctcgacgaggcattcttacgcgccgag
gccgatgacgaagtccgggtggtaatcctggcggcgcgcggcaggaacttctccgccggc
cacgacctgggctccgaggccgcgctggccgaacgcaagcccggtccggcccagcatccg
acgtttcgcgggtatggcgccacccgcgatccgatcgccgagaaaacgtttttgcaggaa
tggcacttctatttccagaacacctgccgctggcgggacctgcgcaagatcaccatcgct
caggtgcagggcaatgcaatatccgcaggtctgatgctgatctgggcatgcgacctcatt
gtcgccgccgacaacgcgaagttttccgacgtagtcggcgtccgcatgggtatgccgggc
gtcgaatactacgctcacccttgggaattcggcccgcgtaaagcgaaagaactgctgttg
accggtgattcgttggacgccgacgaggcgtaccggctcggcatggtgtccaaggtcttt
ccgctcgaccagctcgaggagaagacgttggaattcgcgcggcgcattgccgagcggccg
acgatggcggcgctgctgatcaaagactcggtgaacgccgcgtccgatgcgatgggattc
accgaggcgctgcggcacgcgttccatgttcacgagctcggacatgcgcactgggcggcg
cgcaacgaaaaccgctatcccgtggggctgccgcccgatgtggaggactggcgcaacgca
aagccgtcaaagatcgcccgccgcgacgagccataa

KEGG   Mycobacterium noviomagense: MNVI_11980
Entry
MNVI_11980        CDS       T06809                                 

Gene name
echA19_1
Definition
(GenBank) enoyl-CoA hydratase
  KO
K01692  enoyl-CoA hydratase [EC:4.2.1.17]
Organism
mnv  Mycobacterium noviomagense
Pathway
mnv00071  Fatty acid degradation
mnv00280  Valine, leucine and isoleucine degradation
mnv00281  Geraniol degradation
mnv00310  Lysine degradation
mnv00360  Phenylalanine metabolism
mnv00362  Benzoate degradation
mnv00380  Tryptophan metabolism
mnv00410  beta-Alanine metabolism
mnv00627  Aminobenzoate degradation
mnv00640  Propanoate metabolism
mnv00650  Butanoate metabolism
mnv00903  Limonene and pinene degradation
mnv00930  Caprolactam degradation
mnv01100  Metabolic pathways
mnv01110  Biosynthesis of secondary metabolites
mnv01120  Microbial metabolism in diverse environments
mnv01212  Fatty acid metabolism
Module
mnv_M00087  beta-Oxidation
Brite
KEGG Orthology (KO) [BR:mnv00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00640 Propanoate metabolism
    MNVI_11980 (echA19_1)
   00650 Butanoate metabolism
    MNVI_11980 (echA19_1)
  09103 Lipid metabolism
   00071 Fatty acid degradation
    MNVI_11980 (echA19_1)
  09105 Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    MNVI_11980 (echA19_1)
   00310 Lysine degradation
    MNVI_11980 (echA19_1)
   00360 Phenylalanine metabolism
    MNVI_11980 (echA19_1)
   00380 Tryptophan metabolism
    MNVI_11980 (echA19_1)
  09106 Metabolism of other amino acids
   00410 beta-Alanine metabolism
    MNVI_11980 (echA19_1)
  09109 Metabolism of terpenoids and polyketides
   00903 Limonene and pinene degradation
    MNVI_11980 (echA19_1)
   00281 Geraniol degradation
    MNVI_11980 (echA19_1)
  09111 Xenobiotics biodegradation and metabolism
   00362 Benzoate degradation
    MNVI_11980 (echA19_1)
   00627 Aminobenzoate degradation
    MNVI_11980 (echA19_1)
   00930 Caprolactam degradation
    MNVI_11980 (echA19_1)
Enzymes [BR:mnv01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.17  enoyl-CoA hydratase
     MNVI_11980 (echA19_1)
SSDB
Motif
Pfam: ECH_1 ECH_2
Other DBs
NCBI-ProteinID: BBY05880
UniProt: A0A7I7PB94
Position
1265584..1266384
AA seq 266 aa
MSEPEKQPDALVEQRGHTLVVTLNRPEARNALSTEMMQIMVEAWDRVDNDPDIRCCILTG
AGGYFCAGMDLKAATARPPGDSFKDGSYDPSRIDALLKGRRLNKPLIAAVEGPAIAGGTE
ILQGTDIRVAGESAKFGISEAKWSLYPMGGSAVRLVRQIPYTVACDLLLTGRHITATEAK
EIGLIGYVVPDGQALTKALEIAEVISNNGPLAVQAILRSIRDTEGLPENKAFKIDTQLGI
KVFLSDDAKEGPLAFKEKRTPQFKGR
NT seq 801 nt   +upstreamnt  +downstreamnt
gtgagcgagcctgaaaaacaacccgacgccctcgttgagcagcgcggacacaccctcgtc
gtcacgctgaaccggcccgaggctcgcaacgcgctgagcaccgaaatgatgcaaatcatg
gtcgaggcgtgggaccgcgtcgacaacgatcccgacatccgctgctgcatcctgaccggc
gccggcggctacttctgcgcgggcatggacctcaaagccgcgaccgccaggccaccgggc
gactcgttcaaggacggcagctacgacccgtcgcgcatcgacgcgctgctcaagggccgt
cggctgaacaaaccgctgatcgccgcggtcgagggcccggccatcgccggcgggactgag
atcctgcaaggcaccgacatccgggtcgccggtgagagcgccaagttcggcatctccgag
gccaagtggagcctgtatccaatgggcggctcggcggtgcgcctggtgcggcagatcccc
tacaccgtggcctgcgacctgctgctgaccggccggcacatcacagccaccgaggccaag
gagattgggctgatcggctatgtggtgcccgacgggcaggcgctgaccaaggcgctggag
atcgcggaggtcatctcgaacaacggtccgctggccgtgcaggcgatcctgcggtccatc
cgggataccgaaggcctgccagaaaacaaggcgttcaagatcgacacccagctcgggatc
aaggtgttcctgtccgacgacgccaaggaaggccccttggcgttcaaggagaaacgcacc
ccgcagttcaaaggtcgctga

KEGG   Mycobacterium noviomagense: MNVI_12340
Entry
MNVI_12340        CDS       T06809                                 

Definition
(GenBank) enoyl-CoA hydratase
  KO
K01692  enoyl-CoA hydratase [EC:4.2.1.17]
Organism
mnv  Mycobacterium noviomagense
Pathway
mnv00071  Fatty acid degradation
mnv00280  Valine, leucine and isoleucine degradation
mnv00281  Geraniol degradation
mnv00310  Lysine degradation
mnv00360  Phenylalanine metabolism
mnv00362  Benzoate degradation
mnv00380  Tryptophan metabolism
mnv00410  beta-Alanine metabolism
mnv00627  Aminobenzoate degradation
mnv00640  Propanoate metabolism
mnv00650  Butanoate metabolism
mnv00903  Limonene and pinene degradation
mnv00930  Caprolactam degradation
mnv01100  Metabolic pathways
mnv01110  Biosynthesis of secondary metabolites
mnv01120  Microbial metabolism in diverse environments
mnv01212  Fatty acid metabolism
Module
mnv_M00087  beta-Oxidation
Brite
KEGG Orthology (KO) [BR:mnv00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00640 Propanoate metabolism
    MNVI_12340
   00650 Butanoate metabolism
    MNVI_12340
  09103 Lipid metabolism
   00071 Fatty acid degradation
    MNVI_12340
  09105 Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    MNVI_12340
   00310 Lysine degradation
    MNVI_12340
   00360 Phenylalanine metabolism
    MNVI_12340
   00380 Tryptophan metabolism
    MNVI_12340
  09106 Metabolism of other amino acids
   00410 beta-Alanine metabolism
    MNVI_12340
  09109 Metabolism of terpenoids and polyketides
   00903 Limonene and pinene degradation
    MNVI_12340
   00281 Geraniol degradation
    MNVI_12340
  09111 Xenobiotics biodegradation and metabolism
   00362 Benzoate degradation
    MNVI_12340
   00627 Aminobenzoate degradation
    MNVI_12340
   00930 Caprolactam degradation
    MNVI_12340
Enzymes [BR:mnv01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.17  enoyl-CoA hydratase
     MNVI_12340
SSDB
Motif
Pfam: ECH_1 ECH_2
Other DBs
NCBI-ProteinID: BBY05916
UniProt: A0A7I7PBK4
Position
1298799..1299560
AA seq 253 aa
MPITSMKTEPGIVAVTVDYPPVNAIPSRGWFELADAVTAAGRGPDTHVVILRAEGRGFNA
GVDIKEMQRTEGFTALIDANRGCFAAFKAVYECAVPVVAAVNGFCVGGGIGLVGNSDVIV
ASDDATFGLPEVERGALGAATHLSRLVPQHMMRRLFFTAATVDAATLHHFGSVHEVVPRE
ELDEAALRVARDIAAKDTRVIRAAKEALNFIDVQRVNSSYRMEQGFTFELNLAGVSDEHR
DAFAGTAKADKKS
NT seq 762 nt   +upstreamnt  +downstreamnt
atgccgatcacgtccatgaaaaccgagccgggcatagtcgccgtcacggtcgactatccg
ccggtcaacgccatcccgtcgcgcggctggttcgaactcgccgatgctgtgacggctgcg
ggccgcggcccggacacccacgtggtgatcctgcgcgccgaaggccgcggcttcaatgcc
ggggtcgacatcaaggagatgcagcgcactgagggattcaccgcgctgatcgacgccaac
cgcggctgcttcgcggcgttcaaggccgtctacgaatgcgcggtcccggtagttgccgcc
gtcaacggattctgtgtcggcggcggtatcgggctggtcggcaactcggatgtcatcgtg
gcctccgatgacgccacgttcgggctcccagaagtggaacggggcgcgctgggggcggcg
acacatctgtcgcggctggtgccgcagcacatgatgcgccgactcttcttcaccgccgcc
acagtcgacgccgcaaccttgcaccacttcggttcggtgcacgaggtggtgcctcgagag
gagttggacgaggccgcgttacgagtcgcccgcgacatcgcggccaaggacacccgggtg
atccgggccgccaaagaggcgctgaacttcatcgacgtgcagcgggtgaactccagttac
cgtatggagcaaggcttcacgttcgagctcaacctcgcgggggtctccgacgagcatcgc
gacgcgtttgccggcacggccaaggcggacaagaagtcatga

KEGG   Mycobacterium noviomagense: MNVI_15010
Entry
MNVI_15010        CDS       T06809                                 

Gene name
echA21
Definition
(GenBank) enoyl-CoA hydratase
  KO
K01692  enoyl-CoA hydratase [EC:4.2.1.17]
Organism
mnv  Mycobacterium noviomagense
Pathway
mnv00071  Fatty acid degradation
mnv00280  Valine, leucine and isoleucine degradation
mnv00281  Geraniol degradation
mnv00310  Lysine degradation
mnv00360  Phenylalanine metabolism
mnv00362  Benzoate degradation
mnv00380  Tryptophan metabolism
mnv00410  beta-Alanine metabolism
mnv00627  Aminobenzoate degradation
mnv00640  Propanoate metabolism
mnv00650  Butanoate metabolism
mnv00903  Limonene and pinene degradation
mnv00930  Caprolactam degradation
mnv01100  Metabolic pathways
mnv01110  Biosynthesis of secondary metabolites
mnv01120  Microbial metabolism in diverse environments
mnv01212  Fatty acid metabolism
Module
mnv_M00087  beta-Oxidation
Brite
KEGG Orthology (KO) [BR:mnv00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00640 Propanoate metabolism
    MNVI_15010 (echA21)
   00650 Butanoate metabolism
    MNVI_15010 (echA21)
  09103 Lipid metabolism
   00071 Fatty acid degradation
    MNVI_15010 (echA21)
  09105 Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    MNVI_15010 (echA21)
   00310 Lysine degradation
    MNVI_15010 (echA21)
   00360 Phenylalanine metabolism
    MNVI_15010 (echA21)
   00380 Tryptophan metabolism
    MNVI_15010 (echA21)
  09106 Metabolism of other amino acids
   00410 beta-Alanine metabolism
    MNVI_15010 (echA21)
  09109 Metabolism of terpenoids and polyketides
   00903 Limonene and pinene degradation
    MNVI_15010 (echA21)
   00281 Geraniol degradation
    MNVI_15010 (echA21)
  09111 Xenobiotics biodegradation and metabolism
   00362 Benzoate degradation
    MNVI_15010 (echA21)
   00627 Aminobenzoate degradation
    MNVI_15010 (echA21)
   00930 Caprolactam degradation
    MNVI_15010 (echA21)
Enzymes [BR:mnv01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.17  enoyl-CoA hydratase
     MNVI_15010 (echA21)
SSDB
Motif
Pfam: ECH_1 ECH_2
Other DBs
NCBI-ProteinID: BBY06183
UniProt: A0A7I7PC39
Position
1560924..1561748
AA seq 274 aa
MGDSCESVTIETKDQVAQVTLIGPGKGNAMGPAFWSELPEVFAALDADRDVRAIVMTGSG
RNFSYGLDVPAMGGTFTSLLADGALAGPRADFHAEIQRMQNAINAVADCRTPTIASVHGW
CIGGGVDLISAVDIRYASADAKFSVREVKLAIVADVGSLARLPLILNDGHLRELALTGKD
IDAARAQKIGLVNDVYDDADACLAAAHATAAEIAANPPLAVRGIKDVLDQQRFSRVSESL
RYVAAWNAAFLPSKDLTEGISATFEKRPPQFTGE
NT seq 825 nt   +upstreamnt  +downstreamnt
atgggcgactcgtgcgaatccgtcaccatcgaaaccaaggaccaggtcgcgcaggtgacg
ctgatcgggccgggcaagggcaatgcgatgggacccgcgttctggtcggagctgccggag
gtgtttgccgcgctggacgccgaccgcgacgtgcgggcgatcgtcatgaccgggtctggc
cgcaatttcagttacggcctcgatgtgccggcgatgggcgggaccttcacttcgctgctg
gccgacggtgcgctggccggcccgcgcgccgactttcacgccgagatccagcgaatgcag
aacgcgatcaacgcggtcgccgactgccggacccccacgatcgcctcggtgcacggctgg
tgcattggcggcggcgtcgacctaatatccgcggtggatatccgctacgccagcgccgac
gcgaaattctcggtgcgcgaggtgaagctggccatcgtcgccgacgtggggagtctcgcc
cggctgccgctgatcttgaacgacggacacctgcgggagctcgcgctgaccggtaaagac
atcgacgcggcccgcgcccagaaaatcggtctggtcaacgacgtgtacgacgacgccgac
gcctgcctggccgccgcacacgccaccgccgctgagatcgctgccaatccgccgctggcc
gtccgcgggatcaaggatgtccttgaccagcaacggttttcgcgggtatcggaaagcctg
cgctatgtcgcggcgtggaacgcggccttcctgccgtccaaagatctgaccgagggcatc
tcggcgacgttcgagaagcggccgccgcagttcaccggcgaatag

KEGG   Mycobacterium noviomagense: MNVI_17800
Entry
MNVI_17800        CDS       T06809                                 

Gene name
paaG
Definition
(GenBank) enoyl-CoA hydratase
  KO
K01692  enoyl-CoA hydratase [EC:4.2.1.17]
Organism
mnv  Mycobacterium noviomagense
Pathway
mnv00071  Fatty acid degradation
mnv00280  Valine, leucine and isoleucine degradation
mnv00281  Geraniol degradation
mnv00310  Lysine degradation
mnv00360  Phenylalanine metabolism
mnv00362  Benzoate degradation
mnv00380  Tryptophan metabolism
mnv00410  beta-Alanine metabolism
mnv00627  Aminobenzoate degradation
mnv00640  Propanoate metabolism
mnv00650  Butanoate metabolism
mnv00903  Limonene and pinene degradation
mnv00930  Caprolactam degradation
mnv01100  Metabolic pathways
mnv01110  Biosynthesis of secondary metabolites
mnv01120  Microbial metabolism in diverse environments
mnv01212  Fatty acid metabolism
Module
mnv_M00087  beta-Oxidation
Brite
KEGG Orthology (KO) [BR:mnv00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00640 Propanoate metabolism
    MNVI_17800 (paaG)
   00650 Butanoate metabolism
    MNVI_17800 (paaG)
  09103 Lipid metabolism
   00071 Fatty acid degradation
    MNVI_17800 (paaG)
  09105 Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    MNVI_17800 (paaG)
   00310 Lysine degradation
    MNVI_17800 (paaG)
   00360 Phenylalanine metabolism
    MNVI_17800 (paaG)
   00380 Tryptophan metabolism
    MNVI_17800 (paaG)
  09106 Metabolism of other amino acids
   00410 beta-Alanine metabolism
    MNVI_17800 (paaG)
  09109 Metabolism of terpenoids and polyketides
   00903 Limonene and pinene degradation
    MNVI_17800 (paaG)
   00281 Geraniol degradation
    MNVI_17800 (paaG)
  09111 Xenobiotics biodegradation and metabolism
   00362 Benzoate degradation
    MNVI_17800 (paaG)
   00627 Aminobenzoate degradation
    MNVI_17800 (paaG)
   00930 Caprolactam degradation
    MNVI_17800 (paaG)
Enzymes [BR:mnv01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.17  enoyl-CoA hydratase
     MNVI_17800 (paaG)
SSDB
Motif
Pfam: ECH_1 ECH_2 LMWPc
Other DBs
NCBI-ProteinID: BBY06462
UniProt: A0A7I7PD19
Position
1930253..1930984
AA seq 243 aa
METEARDGVTVIGFDHPPVNALDLALLDDVVATMRRVDGPVVITGKGKCFSAGVDLPALI
GGGPEYTDRFITALSAAFLAVFDHPAPVVAAINGHAIAGGCVFAMCADIRLMSAGTIGLT
ELAVGVPFPVAALEICRSAMGTSVTRAALQANTIDVDSAAARGWVDLVVPAAELTAEAVA
IARRLGEYSPAAYAATKEQLHRPAHEAIAAGAEVDTKTRAGWLAEDTRGRITAFVKAFGR
DHR
NT seq 732 nt   +upstreamnt  +downstreamnt
atggagacagaagcccgagacggcgtgacggtcatcggcttcgaccatccgccggtgaat
gctcttgacctcgcgctgctcgacgacgtggtcgcgaccatgcgccgcgtcgacggccca
gtggtcatcactggcaaaggcaagtgcttttcggccggcgtcgacttgccggcgctcatc
ggcggcggacctgagtacaccgatcgcttcatcaccgctctctccgcggctttcctcgcc
gtcttcgaccacccggcgccggtggtcgcggcgatcaacgggcatgccattgcgggcgga
tgcgtcttcgccatgtgcgccgacatccgactcatgtccgccgggacgatcggcctcact
gagctcgcagtcggggtcccgttcccagtggccgccctcgagatatgccgctctgcgatg
ggcacctcggtcacccgggcagcgctgcaagccaacacgattgacgtggattcggcggcg
gctcggggctgggtcgatctggtggtccccgccgccgagctcacagcggaggctgttgcg
atcgcgcgtcgactcggcgagtattcgccggcagcgtacgcggctaccaaggaacagctg
caccggccggctcacgaggcgatcgctgccggcgccgaagtggatacgaagacgcgggcc
ggctggctggccgaagacactcgcggccgaatcaccgcgtttgtcaaggcgtttgggcgc
gatcaccgctag

KEGG   Mycobacterium noviomagense: MNVI_19570
Entry
MNVI_19570        CDS       T06809                                 

Gene name
echA1
Definition
(GenBank) enoyl-CoA hydratase
  KO
K01692  enoyl-CoA hydratase [EC:4.2.1.17]
Organism
mnv  Mycobacterium noviomagense
Pathway
mnv00071  Fatty acid degradation
mnv00280  Valine, leucine and isoleucine degradation
mnv00281  Geraniol degradation
mnv00310  Lysine degradation
mnv00360  Phenylalanine metabolism
mnv00362  Benzoate degradation
mnv00380  Tryptophan metabolism
mnv00410  beta-Alanine metabolism
mnv00627  Aminobenzoate degradation
mnv00640  Propanoate metabolism
mnv00650  Butanoate metabolism
mnv00903  Limonene and pinene degradation
mnv00930  Caprolactam degradation
mnv01100  Metabolic pathways
mnv01110  Biosynthesis of secondary metabolites
mnv01120  Microbial metabolism in diverse environments
mnv01212  Fatty acid metabolism
Module
mnv_M00087  beta-Oxidation
Brite
KEGG Orthology (KO) [BR:mnv00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00640 Propanoate metabolism
    MNVI_19570 (echA1)
   00650 Butanoate metabolism
    MNVI_19570 (echA1)
  09103 Lipid metabolism
   00071 Fatty acid degradation
    MNVI_19570 (echA1)
  09105 Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    MNVI_19570 (echA1)
   00310 Lysine degradation
    MNVI_19570 (echA1)
   00360 Phenylalanine metabolism
    MNVI_19570 (echA1)
   00380 Tryptophan metabolism
    MNVI_19570 (echA1)
  09106 Metabolism of other amino acids
   00410 beta-Alanine metabolism
    MNVI_19570 (echA1)
  09109 Metabolism of terpenoids and polyketides
   00903 Limonene and pinene degradation
    MNVI_19570 (echA1)
   00281 Geraniol degradation
    MNVI_19570 (echA1)
  09111 Xenobiotics biodegradation and metabolism
   00362 Benzoate degradation
    MNVI_19570 (echA1)
   00627 Aminobenzoate degradation
    MNVI_19570 (echA1)
   00930 Caprolactam degradation
    MNVI_19570 (echA1)
Enzymes [BR:mnv01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.17  enoyl-CoA hydratase
     MNVI_19570 (echA1)
SSDB
Motif
Pfam: ECH_1 ECH_2 Peptidase_S49
Other DBs
NCBI-ProteinID: BBY06639
UniProt: A0A7I7PDQ4
Position
2108683..2109465
AA seq 260 aa
MSAEAENSQPVVLTEQRDRILIITINRPEAKNAVNAAVSQGLADAMDHLDGDTGLSVGIL
TGAGGSFCAGMDLKAFARGENVIVEGRGMGFTERPPAKPVIAAVEGYALAGGTELALATD
LIVASTDSAFGIPEVKRGLVAGGGGLLRLPQRIPYAIAMELALTGDNLPAERAHALGLVN
VLAEPGNALDEAIKLAEKITANGPLAVAATKRIIVESRGWSPQTMFAEQMKILMPVFASN
DAKEGAIAFAEKRAPRWTGT
NT seq 783 nt   +upstreamnt  +downstreamnt
gtgagcgcagaagccgaaaacagccagcccgtagtcctaaccgaacagcgcgaccgcatc
ctgatcatcacgatcaaccgcccggaggcgaagaacgcggtcaacgccgcggtcagccag
ggccttgccgatgcgatggaccacctcgacggcgataccgggctttcggtggggattttg
accggggcaggtggctcgttttgtgcgggcatggatctcaaggcgttcgcgcgtggcgag
aacgtcatcgtcgagggccgcggcatgggcttcaccgagcgtccgcccgccaaaccggtg
atcgccgcggtcgagggctacgcgctggccggcggcacggaactggcgttggccaccgac
ctgatcgtggcgtcgacggattcggcgttcggaatccccgaggtcaaacgcgggctggtc
gccggcgggggagggttgctgcggctgccgcagcgcatcccatacgcgatcgccatggag
ctggcgctcaccggcgacaacctgcccgcggaacgggcgcatgcgctggggctggtcaac
gtgttggccgagcccggcaacgcactggacgaggcgatcaagctcgcggagaagatcacc
gccaacggtccacttgcagtggcggccaccaagcggatcatcgtcgagtcgcgcggttgg
agcccgcagacgatgttcgccgagcagatgaaaatcctgatgccggtgttcgcgtccaac
gacgccaaggaaggggcgatcgcgttcgccgagaagcgggcgccgcgctggaccgggacg
tga

KEGG   Mycobacterium noviomagense: MNVI_24670
Entry
MNVI_24670        CDS       T06809                                 

Gene name
echA3
Definition
(GenBank) enoyl-CoA hydratase
  KO
K01692  enoyl-CoA hydratase [EC:4.2.1.17]
Organism
mnv  Mycobacterium noviomagense
Pathway
mnv00071  Fatty acid degradation
mnv00280  Valine, leucine and isoleucine degradation
mnv00281  Geraniol degradation
mnv00310  Lysine degradation
mnv00360  Phenylalanine metabolism
mnv00362  Benzoate degradation
mnv00380  Tryptophan metabolism
mnv00410  beta-Alanine metabolism
mnv00627  Aminobenzoate degradation
mnv00640  Propanoate metabolism
mnv00650  Butanoate metabolism
mnv00903  Limonene and pinene degradation
mnv00930  Caprolactam degradation
mnv01100  Metabolic pathways
mnv01110  Biosynthesis of secondary metabolites
mnv01120  Microbial metabolism in diverse environments
mnv01212  Fatty acid metabolism
Module
mnv_M00087  beta-Oxidation
Brite
KEGG Orthology (KO) [BR:mnv00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00640 Propanoate metabolism
    MNVI_24670 (echA3)
   00650 Butanoate metabolism
    MNVI_24670 (echA3)
  09103 Lipid metabolism
   00071 Fatty acid degradation
    MNVI_24670 (echA3)
  09105 Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    MNVI_24670 (echA3)
   00310 Lysine degradation
    MNVI_24670 (echA3)
   00360 Phenylalanine metabolism
    MNVI_24670 (echA3)
   00380 Tryptophan metabolism
    MNVI_24670 (echA3)
  09106 Metabolism of other amino acids
   00410 beta-Alanine metabolism
    MNVI_24670 (echA3)
  09109 Metabolism of terpenoids and polyketides
   00903 Limonene and pinene degradation
    MNVI_24670 (echA3)
   00281 Geraniol degradation
    MNVI_24670 (echA3)
  09111 Xenobiotics biodegradation and metabolism
   00362 Benzoate degradation
    MNVI_24670 (echA3)
   00627 Aminobenzoate degradation
    MNVI_24670 (echA3)
   00930 Caprolactam degradation
    MNVI_24670 (echA3)
Enzymes [BR:mnv01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.17  enoyl-CoA hydratase
     MNVI_24670 (echA3)
SSDB
Motif
Pfam: ECH_1 ECH_2 CLP_protease
Other DBs
NCBI-ProteinID: BBY07149
UniProt: A0A7I7PF60
Position
complement(2645729..2646415)
AA seq 228 aa
MVSYHYDDPIAVIKMDDGKVNALGPTMQQALNEALDNADRDDAGAVVISGNDRVFSGGFD
LKILTSGQVEPALDMLKGGFELAHRLLSYPKPVVMACTGHAIAMGAFLLSSGDHRIAAPA
YNIQANEVAIGMTIPYPALEIMKLRLTPSAYQQAVGLAKTFFGETAIAAGWLDEIVLPDV
VRSRAEEAAREFATLSQRAHAASKLRTRAEALQGIRAGIDGMAAEFGR
NT seq 687 nt   +upstreamnt  +downstreamnt
atggtcagctatcactacgacgacccgatcgcggtcatcaagatggacgacggcaaggtc
aacgcgctgggcccgactatgcagcaggccctcaatgaagcgctcgacaacgccgaccgc
gacgacgctggcgctgttgtgatctcgggcaatgatcgggttttcagcggcggattcgac
ctgaagatcttgacctccgggcaggtggagccggctctcgacatgctcaagggcggcttc
gagctggcccaccggctgttgtcgtaccccaagccggtggtgatggcgtgtaccgggcac
gcgatcgcgatgggcgcattcctgctgtccagcggagaccatcgaatcgccgcgccggcg
tacaacattcaggccaacgaagtcgcgatcgggatgacgattccgtacccggcgctggag
atcatgaagcttcggctgacgccgtcggcgtatcagcaggcggtcggcctggccaagacg
ttcttcggggagaccgcgatcgcggccggctggctcgacgaaatcgtgctgcccgacgtg
gtgcgctcccgcgccgaggaagccgcccgcgaatttgcgacacttagccagcgggcccac
gccgcgagcaagttgcggacacgcgccgaggcgctgcaaggcattcgggccgggatcgac
ggaatggcagccgagttcgggcggtaa

KEGG   Mycobacterium noviomagense: MNVI_25080
Entry
MNVI_25080        CDS       T06809                                 

Gene name
echA4
Definition
(GenBank) enoyl-CoA hydratase
  KO
K01692  enoyl-CoA hydratase [EC:4.2.1.17]
Organism
mnv  Mycobacterium noviomagense
Pathway
mnv00071  Fatty acid degradation
mnv00280  Valine, leucine and isoleucine degradation
mnv00281  Geraniol degradation
mnv00310  Lysine degradation
mnv00360  Phenylalanine metabolism
mnv00362  Benzoate degradation
mnv00380  Tryptophan metabolism
mnv00410  beta-Alanine metabolism
mnv00627  Aminobenzoate degradation
mnv00640  Propanoate metabolism
mnv00650  Butanoate metabolism
mnv00903  Limonene and pinene degradation
mnv00930  Caprolactam degradation
mnv01100  Metabolic pathways
mnv01110  Biosynthesis of secondary metabolites
mnv01120  Microbial metabolism in diverse environments
mnv01212  Fatty acid metabolism
Module
mnv_M00087  beta-Oxidation
Brite
KEGG Orthology (KO) [BR:mnv00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00640 Propanoate metabolism
    MNVI_25080 (echA4)
   00650 Butanoate metabolism
    MNVI_25080 (echA4)
  09103 Lipid metabolism
   00071 Fatty acid degradation
    MNVI_25080 (echA4)
  09105 Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    MNVI_25080 (echA4)
   00310 Lysine degradation
    MNVI_25080 (echA4)
   00360 Phenylalanine metabolism
    MNVI_25080 (echA4)
   00380 Tryptophan metabolism
    MNVI_25080 (echA4)
  09106 Metabolism of other amino acids
   00410 beta-Alanine metabolism
    MNVI_25080 (echA4)
  09109 Metabolism of terpenoids and polyketides
   00903 Limonene and pinene degradation
    MNVI_25080 (echA4)
   00281 Geraniol degradation
    MNVI_25080 (echA4)
  09111 Xenobiotics biodegradation and metabolism
   00362 Benzoate degradation
    MNVI_25080 (echA4)
   00627 Aminobenzoate degradation
    MNVI_25080 (echA4)
   00930 Caprolactam degradation
    MNVI_25080 (echA4)
Enzymes [BR:mnv01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.17  enoyl-CoA hydratase
     MNVI_25080 (echA4)
SSDB
Motif
Pfam: ECH_1 ECH_2 SDH_sah ACP_syn_III_C
Other DBs
NCBI-ProteinID: BBY07190
UniProt: A0A7I7PF38
Position
2688961..2689899
AA seq 312 aa
MTHSIRPVDFDNLKTMTYEVTDRVARITFNRPEKGNAIIADTPLELSALVERADLDAGVH
VILVSGRGEGFCAGFDLSAYADRTASAGGGSAYKGTVLDGKTQAINHLPNQPWDPMIDYQ
MMSRFVRGFSSLMHADKPTVVKIHGYCVAGGTDIALHADQIIAAADAKIGYPPTRVWGVP
AAGMWAHRLGDQRAKRLLLTGDCITGKQAAEWGLAVEAPEPDELDERTERLVERIAAVPV
NQLVMVKLALNSALLQQGVATSRMVSTVFDGVARHTPEGHAFVADAVEHGFREAVRHRDE
PFGDYGRQASGV
NT seq 939 nt   +upstreamnt  +downstreamnt
atgactcactcaatcaggccggtcgacttcgacaacctcaagacgatgacctacgaggtc
accgatcgggttgcgcggattaccttcaaccggccggagaagggcaacgcgatcatcgcc
gatacgccgctggaactttcggcactggtcgagcgggctgacctggacgcaggtgtccac
gtcatcttggtgtccggtcgcggtgaagggttttgcgccggtttcgatctgagcgcctac
gccgaccggacggcatcggcaggcggtggcagcgcatacaagggcacggtcctcgacggc
aagacgcaggcgatcaaccatctgccgaaccagccgtgggacccgatgatcgactatcaa
atgatgagccggttcgtacgcgggttttccagcctgatgcacgccgataagcccaccgtg
gtcaagatccacggctactgcgtggcgggcggcaccgacattgctctgcacgccgatcag
atcatcgccgccgccgacgccaagatcggctacccgccgaccagggtgtggggcgttcct
gccgccggcatgtgggcgcaccggctcggcgaccagcgcgccaaacgccttctgctgacc
ggggattgcatcaccggcaagcaggccgcggaatggggcttggcagtcgaggcgcccgaa
cccgacgagctcgacgagcgcaccgagcggctggtagagcgaatcgccgcggtgccggtc
aaccagctggtcatggtcaagctcgcgctgaattcggcgctgctgcaacagggtgtggcg
accagcagaatggtcagcaccgtcttcgacggcgtcgcgcggcatacacccgaaggccat
gcgtttgtcgccgacgccgtcgagcacggcttccgcgaggcggtgcgtcaccgtgacgag
ccgttcggcgattacggccgtcaagcttccggggtgtag

KEGG   Mycobacterium noviomagense: MNVI_25100
Entry
MNVI_25100        CDS       T06809                                 

Gene name
echA5
Definition
(GenBank) enoyl-CoA hydratase
  KO
K01692  enoyl-CoA hydratase [EC:4.2.1.17]
Organism
mnv  Mycobacterium noviomagense
Pathway
mnv00071  Fatty acid degradation
mnv00280  Valine, leucine and isoleucine degradation
mnv00281  Geraniol degradation
mnv00310  Lysine degradation
mnv00360  Phenylalanine metabolism
mnv00362  Benzoate degradation
mnv00380  Tryptophan metabolism
mnv00410  beta-Alanine metabolism
mnv00627  Aminobenzoate degradation
mnv00640  Propanoate metabolism
mnv00650  Butanoate metabolism
mnv00903  Limonene and pinene degradation
mnv00930  Caprolactam degradation
mnv01100  Metabolic pathways
mnv01110  Biosynthesis of secondary metabolites
mnv01120  Microbial metabolism in diverse environments
mnv01212  Fatty acid metabolism
Module
mnv_M00087  beta-Oxidation
Brite
KEGG Orthology (KO) [BR:mnv00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00640 Propanoate metabolism
    MNVI_25100 (echA5)
   00650 Butanoate metabolism
    MNVI_25100 (echA5)
  09103 Lipid metabolism
   00071 Fatty acid degradation
    MNVI_25100 (echA5)
  09105 Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    MNVI_25100 (echA5)
   00310 Lysine degradation
    MNVI_25100 (echA5)
   00360 Phenylalanine metabolism
    MNVI_25100 (echA5)
   00380 Tryptophan metabolism
    MNVI_25100 (echA5)
  09106 Metabolism of other amino acids
   00410 beta-Alanine metabolism
    MNVI_25100 (echA5)
  09109 Metabolism of terpenoids and polyketides
   00903 Limonene and pinene degradation
    MNVI_25100 (echA5)
   00281 Geraniol degradation
    MNVI_25100 (echA5)
  09111 Xenobiotics biodegradation and metabolism
   00362 Benzoate degradation
    MNVI_25100 (echA5)
   00627 Aminobenzoate degradation
    MNVI_25100 (echA5)
   00930 Caprolactam degradation
    MNVI_25100 (echA5)
Enzymes [BR:mnv01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.17  enoyl-CoA hydratase
     MNVI_25100 (echA5)
SSDB
Motif
Pfam: ECH_1 ECH_2
Other DBs
NCBI-ProteinID: BBY07192
UniProt: A0A7I7PF88
Position
2690634..2691401
AA seq 255 aa
MSDQVRVEHTGPVTTVILNRPQARNAVNGPTAAALFAAFEQFDRDDDASVAVLWGEGGTF
CAGADLKAFGTPEANAVHRTGPGPMGPTRMVLSKPVIAAVSGYAVAGGLELALWCDLRVA
EEDAVFGVFCRRWGVPLIDGGTVRLPRLIGHSRAMDMILTGRGVKADEALAIGLANRVVP
KGQSRQAAEELAAELAALPQQCMRSDRLSALHQWGLPEPEALDFEFASISRVSAEAMEGA
GRFAAGAGRHGTPAV
NT seq 768 nt   +upstreamnt  +downstreamnt
atgagcgaccaggtacgcgtagagcacaccggcccggtgaccacggtgatcttgaaccgc
ccgcaggcccgcaatgccgtcaacggcccgacggctgctgcgttgttcgcagcgttcgag
cagttcgaccgcgacgacgacgcttcggtggcggtgttgtggggagagggcggaacgttc
tgcgccggcgccgatttgaaggcgttcggtactcccgaggctaacgcggtgcaccgcacc
ggccccgggccgatggggccgacccggatggtgttgtccaagccggtgatcgccgcggtc
agcggttacgcggtcgccggaggtctggaactcgcgctgtggtgcgacctgcgggtggcc
gaagaagacgccgtgttcggggtgttctgccgacgctggggtgtccccctgatcgacggc
ggcaccgtccgcctgccgcggctgatcgggcacagtcgcgcgatggacatgatcctgacc
ggccgcggcgtcaaggccgacgaagcgttggcgatcgggctggccaatcgcgttgtgccc
aaagggcaatcacgtcaggccgccgaagaactggccgccgagctggccgcgttgccgcaa
cagtgcatgcgctcggatcggctgtcggcattgcatcagtggggcctgccggagcccgag
gcgctcgatttcgagttcgccagcatttcccgggtctccgctgaggccatggaaggcgcg
ggacgcttcgccgccggcgccggtcgtcacggaaccccggccgtctag

KEGG   Mycobacterium noviomagense: MNVI_29380
Entry
MNVI_29380        CDS       T06809                                 

Definition
(GenBank) enoyl-CoA hydratase
  KO
K01692  enoyl-CoA hydratase [EC:4.2.1.17]
Organism
mnv  Mycobacterium noviomagense
Pathway
mnv00071  Fatty acid degradation
mnv00280  Valine, leucine and isoleucine degradation
mnv00281  Geraniol degradation
mnv00310  Lysine degradation
mnv00360  Phenylalanine metabolism
mnv00362  Benzoate degradation
mnv00380  Tryptophan metabolism
mnv00410  beta-Alanine metabolism
mnv00627  Aminobenzoate degradation
mnv00640  Propanoate metabolism
mnv00650  Butanoate metabolism
mnv00903  Limonene and pinene degradation
mnv00930  Caprolactam degradation
mnv01100  Metabolic pathways
mnv01110  Biosynthesis of secondary metabolites
mnv01120  Microbial metabolism in diverse environments
mnv01212  Fatty acid metabolism
Module
mnv_M00087  beta-Oxidation
Brite
KEGG Orthology (KO) [BR:mnv00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00640 Propanoate metabolism
    MNVI_29380
   00650 Butanoate metabolism
    MNVI_29380
  09103 Lipid metabolism
   00071 Fatty acid degradation
    MNVI_29380
  09105 Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    MNVI_29380
   00310 Lysine degradation
    MNVI_29380
   00360 Phenylalanine metabolism
    MNVI_29380
   00380 Tryptophan metabolism
    MNVI_29380
  09106 Metabolism of other amino acids
   00410 beta-Alanine metabolism
    MNVI_29380
  09109 Metabolism of terpenoids and polyketides
   00903 Limonene and pinene degradation
    MNVI_29380
   00281 Geraniol degradation
    MNVI_29380
  09111 Xenobiotics biodegradation and metabolism
   00362 Benzoate degradation
    MNVI_29380
   00627 Aminobenzoate degradation
    MNVI_29380
   00930 Caprolactam degradation
    MNVI_29380
Enzymes [BR:mnv01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.17  enoyl-CoA hydratase
     MNVI_29380
SSDB
Motif
Pfam: ECH_1 ECH_2
Other DBs
NCBI-ProteinID: BBY07620
UniProt: A0A7I7PGA2
Position
complement(3104001..3104777)
AA seq 258 aa
MPTRQWVLVEDDGAVRLLAMNRPEARNALNVGLIEALDAALCEADAEPLIRAVVLTGVDP
AFCAGVDLKEAQREGMSYFERYQTHNCITKVAEMATPVIGAINGPVFTGGLEMALGCDFL
IASERAVFADTHVRVGILPGGGMTARLPQLVGAAMARRLSMTGEVINAARAERIGLVTEV
VPHDLLRARAVELAAQVAEVPGPTMAALKEIYATGSAAVTGPALAAEQAIAGTQQTNTAE
LAARYAEISERNRRQIGR
NT seq 777 nt   +upstreamnt  +downstreamnt
atgccgacccggcagtgggttctcgtcgaggacgacggcgcggtccgcctgctggccatg
aaccgcccggaagcgcgaaatgcgttgaatgtcgggctgatcgaagcgctcgatgcggcg
ttgtgcgaggctgacgccgagccgttgattcgcgcggtggtgctcaccggcgtcgacccc
gccttttgcgccggggtggacttgaaggaggcccagcgcgaaggcatgtcgtacttcgag
cgctaccagacgcacaactgcatcaccaaggtggccgagatggcgaccccggtgatcggg
gcaatcaacggcccggttttcaccggaggactcgaaatggccttgggctgcgactttttg
atcgcatcagaacgcgcggtgttcgccgatacccatgtgcgtgtcggcatcctgcccggc
ggcgggatgacggcccggctgccgcagcttgtcggcgcggcgatggcgcgacggctctcg
atgaccggcgaggtgatcaacgcggcccgagccgagcggatcggtctggtgaccgaagtg
gtgccgcacgacctgctgcgcgcccgcgccgttgaactcgctgcccaggttgcggaggtg
ccggggccaaccatggccgcgctcaaggaaatctacgcgaccggctcggccgctgtcacc
ggcccggcgcttgcggccgaacaggctatcgccggcacgcagcagacgaacaccgcggag
ctggctgcgcgttacgccgagatcagcgagcgcaaccgccgccagattgggcgctag

KEGG   Mycobacterium noviomagense: MNVI_30710
Entry
MNVI_30710        CDS       T06809                                 

Gene name
echA17
Definition
(GenBank) putative enoyl-CoA hydratase echA17
  KO
K01692  enoyl-CoA hydratase [EC:4.2.1.17]
Organism
mnv  Mycobacterium noviomagense
Pathway
mnv00071  Fatty acid degradation
mnv00280  Valine, leucine and isoleucine degradation
mnv00281  Geraniol degradation
mnv00310  Lysine degradation
mnv00360  Phenylalanine metabolism
mnv00362  Benzoate degradation
mnv00380  Tryptophan metabolism
mnv00410  beta-Alanine metabolism
mnv00627  Aminobenzoate degradation
mnv00640  Propanoate metabolism
mnv00650  Butanoate metabolism
mnv00903  Limonene and pinene degradation
mnv00930  Caprolactam degradation
mnv01100  Metabolic pathways
mnv01110  Biosynthesis of secondary metabolites
mnv01120  Microbial metabolism in diverse environments
mnv01212  Fatty acid metabolism
Module
mnv_M00087  beta-Oxidation
Brite
KEGG Orthology (KO) [BR:mnv00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00640 Propanoate metabolism
    MNVI_30710 (echA17)
   00650 Butanoate metabolism
    MNVI_30710 (echA17)
  09103 Lipid metabolism
   00071 Fatty acid degradation
    MNVI_30710 (echA17)
  09105 Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    MNVI_30710 (echA17)
   00310 Lysine degradation
    MNVI_30710 (echA17)
   00360 Phenylalanine metabolism
    MNVI_30710 (echA17)
   00380 Tryptophan metabolism
    MNVI_30710 (echA17)
  09106 Metabolism of other amino acids
   00410 beta-Alanine metabolism
    MNVI_30710 (echA17)
  09109 Metabolism of terpenoids and polyketides
   00903 Limonene and pinene degradation
    MNVI_30710 (echA17)
   00281 Geraniol degradation
    MNVI_30710 (echA17)
  09111 Xenobiotics biodegradation and metabolism
   00362 Benzoate degradation
    MNVI_30710 (echA17)
   00627 Aminobenzoate degradation
    MNVI_30710 (echA17)
   00930 Caprolactam degradation
    MNVI_30710 (echA17)
Enzymes [BR:mnv01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.17  enoyl-CoA hydratase
     MNVI_30710 (echA17)
SSDB
Motif
Pfam: ECH_1 ECH_2
Other DBs
NCBI-ProteinID: BBY07753
UniProt: A0A7I7PGP2
Position
3228521..3229261
AA seq 246 aa
MSEFVSVYLGADHPGVATLVLSRPPTNAMTRQVYREIIAAAAELGRRDDVAAVILFGGHE
IFSAGDDMPALRALSPQEAETWARVRHEAIEAVGAIPKPTVAAITGYALGAGLTLAFAAD
WRVSGDNAKFGATEILAGLIPDGAAMARLTRTLGPSRAKELVYSGRFFGAEEALMLGVID
EMVAPDDVYDAAAAWAGRFVEGPAHALAAAKAGVDDVFELSRSERLAAERRRYLEVFART
CHQDDG
NT seq 741 nt   +upstreamnt  +downstreamnt
gtgagcgagttcgtcagcgtctacctgggggctgaccatcccggtgtggccactctggtg
ttgtcgcggccgcccaccaacgcgatgacccgccaggtgtatcgggagatcattgcggcg
gctgccgagttgggccggcgcgacgatgtggcggcggtgatcctgttcggcggccacgag
atcttctccgcaggcgacgacatgcccgcgctgcgggcgctgagccctcaggaggccgag
acctgggcgcgggtgcgccacgaggctatcgaggccgtcggcgccatacccaagcccact
gtcgctgcgatcaccggctacgcgctgggcgccggcctgaccctcgccttcgccgccgat
tggcgggtgagcggggacaacgcgaagttcggggcgaccgagatcctggccggcctgatt
cccgatggcgcggcgatggcgcggctgacccgcacgcttgggcccagccgtgccaaagaa
ctggtgtacagcgggcgtttcttcggcgccgaagaggcgttgatgctcggcgtgatcgac
gagatggtggcacccgacgacgtctacgacgcggccgcggcgtgggcaggccggttcgtc
gaaggcccggcacacgcgctggcggctgccaaagccggcgtcgacgacgtcttcgagctg
agtcgctccgaacggctcgccgctgagcggcgccgctacctggaggtgttcgcccgcacc
tgccaccaagacgacggttag

KEGG   Mycobacterium noviomagense: MNVI_33150
Entry
MNVI_33150        CDS       T06809                                 

Gene name
echA16
Definition
(GenBank) enoyl-CoA hydratase
  KO
K01692  enoyl-CoA hydratase [EC:4.2.1.17]
Organism
mnv  Mycobacterium noviomagense
Pathway
mnv00071  Fatty acid degradation
mnv00280  Valine, leucine and isoleucine degradation
mnv00281  Geraniol degradation
mnv00310  Lysine degradation
mnv00360  Phenylalanine metabolism
mnv00362  Benzoate degradation
mnv00380  Tryptophan metabolism
mnv00410  beta-Alanine metabolism
mnv00627  Aminobenzoate degradation
mnv00640  Propanoate metabolism
mnv00650  Butanoate metabolism
mnv00903  Limonene and pinene degradation
mnv00930  Caprolactam degradation
mnv01100  Metabolic pathways
mnv01110  Biosynthesis of secondary metabolites
mnv01120  Microbial metabolism in diverse environments
mnv01212  Fatty acid metabolism
Module
mnv_M00087  beta-Oxidation
Brite
KEGG Orthology (KO) [BR:mnv00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00640 Propanoate metabolism
    MNVI_33150 (echA16)
   00650 Butanoate metabolism
    MNVI_33150 (echA16)
  09103 Lipid metabolism
   00071 Fatty acid degradation
    MNVI_33150 (echA16)
  09105 Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    MNVI_33150 (echA16)
   00310 Lysine degradation
    MNVI_33150 (echA16)
   00360 Phenylalanine metabolism
    MNVI_33150 (echA16)
   00380 Tryptophan metabolism
    MNVI_33150 (echA16)
  09106 Metabolism of other amino acids
   00410 beta-Alanine metabolism
    MNVI_33150 (echA16)
  09109 Metabolism of terpenoids and polyketides
   00903 Limonene and pinene degradation
    MNVI_33150 (echA16)
   00281 Geraniol degradation
    MNVI_33150 (echA16)
  09111 Xenobiotics biodegradation and metabolism
   00362 Benzoate degradation
    MNVI_33150 (echA16)
   00627 Aminobenzoate degradation
    MNVI_33150 (echA16)
   00930 Caprolactam degradation
    MNVI_33150 (echA16)
Enzymes [BR:mnv01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.17  enoyl-CoA hydratase
     MNVI_33150 (echA16)
SSDB
Motif
Pfam: ECH_1 ECH_2 Flavodoxin_2
Other DBs
NCBI-ProteinID: BBY07997
UniProt: A0A7I7PH89
Position
complement(3480846..3481592)
AA seq 248 aa
MSNMLLIDTDERVRTLTLNRPESRNALSAALRDRFFAALAEAETDDDVDVVILTGADPVF
CAGLDLKELGGQSALPDISPRWPAMTKPVIGAINGAAVTGGLELALYCDILIASEQARFA
DTHARVGLLPTWGLSVRLPQKVGVGLARRMSLTGDYLSADHALRAGLVTEVVPHERLLPA
AREVAASIVGNNQQAVRALLASYHRIDESQTSAGLWLEAAAAREFRTSGDDIAANREAVL
QRGRAQVR
NT seq 747 nt   +upstreamnt  +downstreamnt
atgagcaacatgctgctgatcgacaccgacgagcgggtccgcaccctgaccctgaatcga
cccgaatcgcgcaatgcgctctcggcggcgctgcgcgaccggttcttcgccgccttggct
gaggccgagaccgacgatgacgttgacgtcgtcatcctcaccggcgccgacccggtgttc
tgtgcggggctggacctcaaagagctcggtgggcagtcggcgctgcccgacatctcgccg
cgctggccggcgatgaccaagccggtgatcggagctatcaacggtgccgcggtcaccggt
gggctggagctggcgctgtactgcgacatcctgatcgcctcggaacaagcccggttcgcc
gacacgcatgcccgagtagggctgcttccgacctggggactgagcgtgcggcttccacag
aaggtaggcgtcgggctcgcgcgccggatgagcctcaccggcgactacctgtccgccgac
cacgcgctgcgggccggcctggtcaccgaggtggtgccgcacgagcggctgctgcccgcc
gcccgtgaggtcgcggcatcgatcgtcggcaacaaccaacaagcagtgcgggcattgctg
gcgtcgtatcaccgcatcgacgaatcgcagaccagcgcaggactatggctggaagccgct
gcggcacgggagtttcggaccagcggcgacgacatcgccgccaaccgggaagcggtgctt
cagcgcggacgcgcacaggtgcggtag

KEGG   Mycobacterium noviomagense: MNVI_34550
Entry
MNVI_34550        CDS       T06809                                 

Gene name
echA15
Definition
(GenBank) enoyl-CoA hydratase
  KO
K01692  enoyl-CoA hydratase [EC:4.2.1.17]
Organism
mnv  Mycobacterium noviomagense
Pathway
mnv00071  Fatty acid degradation
mnv00280  Valine, leucine and isoleucine degradation
mnv00281  Geraniol degradation
mnv00310  Lysine degradation
mnv00360  Phenylalanine metabolism
mnv00362  Benzoate degradation
mnv00380  Tryptophan metabolism
mnv00410  beta-Alanine metabolism
mnv00627  Aminobenzoate degradation
mnv00640  Propanoate metabolism
mnv00650  Butanoate metabolism
mnv00903  Limonene and pinene degradation
mnv00930  Caprolactam degradation
mnv01100  Metabolic pathways
mnv01110  Biosynthesis of secondary metabolites
mnv01120  Microbial metabolism in diverse environments
mnv01212  Fatty acid metabolism
Module
mnv_M00087  beta-Oxidation
Brite
KEGG Orthology (KO) [BR:mnv00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00640 Propanoate metabolism
    MNVI_34550 (echA15)
   00650 Butanoate metabolism
    MNVI_34550 (echA15)
  09103 Lipid metabolism
   00071 Fatty acid degradation
    MNVI_34550 (echA15)
  09105 Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    MNVI_34550 (echA15)
   00310 Lysine degradation
    MNVI_34550 (echA15)
   00360 Phenylalanine metabolism
    MNVI_34550 (echA15)
   00380 Tryptophan metabolism
    MNVI_34550 (echA15)
  09106 Metabolism of other amino acids
   00410 beta-Alanine metabolism
    MNVI_34550 (echA15)
  09109 Metabolism of terpenoids and polyketides
   00903 Limonene and pinene degradation
    MNVI_34550 (echA15)
   00281 Geraniol degradation
    MNVI_34550 (echA15)
  09111 Xenobiotics biodegradation and metabolism
   00362 Benzoate degradation
    MNVI_34550 (echA15)
   00627 Aminobenzoate degradation
    MNVI_34550 (echA15)
   00930 Caprolactam degradation
    MNVI_34550 (echA15)
Enzymes [BR:mnv01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.17  enoyl-CoA hydratase
     MNVI_34550 (echA15)
SSDB
Motif
Pfam: ECH_1 ECH_2 TCAD2
Other DBs
NCBI-ProteinID: BBY08137
UniProt: A0A7I7PHL7
Position
complement(3610697..3611533)
AA seq 278 aa
MPVSHPPVRYDEFPSLRIEPATDGVLHVILDAPGLNSVGPQMHRDLADIWPEIERDPEVR
AVLVRGEGKAFSSGGSFDLIEETMGDFADRIRIMREARDLVLNMVNFDKPVVSAIRGPAV
GAGLVVALLADISVAGRSAKIIDGHTKLGVAAGDHAAICWPLLVGMAKAKYYLLTCQPLT
GEEAERIGLVSTCVDDDDVLSTATRIAEDLARGAQTAIRWTKHSLNHWYRMFAPAFETAL
GLEFIGFSGPDVHEGLAANREKRAPRFGADPEARQLQP
NT seq 837 nt   +upstreamnt  +downstreamnt
atgccagtcagccatccccccgtcaggtacgacgagttcccaagtctgcgtatcgaaccg
gccaccgacggtgtgttgcacgtgattctcgatgcgcccgggctcaattcggtggggccg
cagatgcaccgggacctcgccgacatctggccggagatcgagcgtgaccccgaggtgcgt
gcggtgctcgtgcgcggcgaaggaaaagcgttctcctccggcggcagcttcgacttgatc
gaagagacgatgggcgacttcgccgaccggatccgcatcatgcgcgaggcccgcgacctg
gtgctcaacatggtcaacttcgacaagccggtggtttcggcgattcgcgggccggcggtc
ggcgccggtctggtggtggccctgctggccgacatctcggtggccgggcgcagcgccaag
atcatcgacgggcacaccaagctgggggtggccgcgggggatcatgctgcgatctgctgg
ccgctcttggtcggcatggccaaggccaagtactacctgctgacctgccagccgctcacc
ggtgaggaagccgagcgcatcgggctggtgtccacctgtgtcgacgacgacgacgtactg
tccacggcaacccgcatcgccgaagacctcgcgcgcggagcgcaaacggcgatccggtgg
accaaacacagcctcaaccactggtatcgcatgttcgcgcccgcgttcgaaacagccctg
ggcctggagttcatcgggttcagcggccccgacgtgcacgaaggactggccgccaaccgc
gagaagcgcgcgccgcgtttcggcgccgatcccgaggcccgccagctgcagccgtag

KEGG   Mycobacterium noviomagense: MNVI_37670
Entry
MNVI_37670        CDS       T06809                                 

Gene name
echA12
Definition
(GenBank) putative enoyl-CoA hydratase echA12
  KO
K01692  enoyl-CoA hydratase [EC:4.2.1.17]
Organism
mnv  Mycobacterium noviomagense
Pathway
mnv00071  Fatty acid degradation
mnv00280  Valine, leucine and isoleucine degradation
mnv00281  Geraniol degradation
mnv00310  Lysine degradation
mnv00360  Phenylalanine metabolism
mnv00362  Benzoate degradation
mnv00380  Tryptophan metabolism
mnv00410  beta-Alanine metabolism
mnv00627  Aminobenzoate degradation
mnv00640  Propanoate metabolism
mnv00650  Butanoate metabolism
mnv00903  Limonene and pinene degradation
mnv00930  Caprolactam degradation
mnv01100  Metabolic pathways
mnv01110  Biosynthesis of secondary metabolites
mnv01120  Microbial metabolism in diverse environments
mnv01212  Fatty acid metabolism
Module
mnv_M00087  beta-Oxidation
Brite
KEGG Orthology (KO) [BR:mnv00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00640 Propanoate metabolism
    MNVI_37670 (echA12)
   00650 Butanoate metabolism
    MNVI_37670 (echA12)
  09103 Lipid metabolism
   00071 Fatty acid degradation
    MNVI_37670 (echA12)
  09105 Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    MNVI_37670 (echA12)
   00310 Lysine degradation
    MNVI_37670 (echA12)
   00360 Phenylalanine metabolism
    MNVI_37670 (echA12)
   00380 Tryptophan metabolism
    MNVI_37670 (echA12)
  09106 Metabolism of other amino acids
   00410 beta-Alanine metabolism
    MNVI_37670 (echA12)
  09109 Metabolism of terpenoids and polyketides
   00903 Limonene and pinene degradation
    MNVI_37670 (echA12)
   00281 Geraniol degradation
    MNVI_37670 (echA12)
  09111 Xenobiotics biodegradation and metabolism
   00362 Benzoate degradation
    MNVI_37670 (echA12)
   00627 Aminobenzoate degradation
    MNVI_37670 (echA12)
   00930 Caprolactam degradation
    MNVI_37670 (echA12)
Enzymes [BR:mnv01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.17  enoyl-CoA hydratase
     MNVI_37670 (echA12)
SSDB
Motif
Pfam: ECH_1 ECH_2
Other DBs
NCBI-ProteinID: BBY08449
UniProt: A0A7I7PIU7
Position
3916581..3917411
AA seq 276 aa
MHSVNSQTGFVRVEHPRPHVALITLNRPERMNSMAFDVMVPLKEALAEVTYDNSVRVVVL
TGAGRGFSSGADHKSAGQVPHVEGLTRPTYALRSMELLDDVILGLRRLHQPVIAAVNGAA
IGGGLCLALAADIRVASTSAYFRAAGINNGLTASELGLSYLLPRAIGSSRAFELMLTGRD
VDAEEAERIGLVSYRVPDEQLLDTCYALAERIAAFSRPGIELTKRTLWSGLDAASLEGHM
QAEGLGQLFVRLLTSNFEEAVAARAEKRPPVFTDDT
NT seq 831 nt   +upstreamnt  +downstreamnt
gtgcactccgtgaattcccagactggctttgtccgtgttgaacacccgcggccgcacgtc
gcgctgatcaccctcaatcggccggagcgcatgaactccatggccttcgatgtcatggtg
ccgctcaaagaggctctggccgaggtcacctacgacaattccgtgcgggttgtcgtgttg
accggagcgggccggggcttctcctcgggcgccgaccacaagtcggcagggcaggtgcca
cacgtcgaggggctgacccggccgacctacgcgctgcgctccatggaactgctcgacgac
gtgatcctggggctgcgccggctccaccaacccgtgattgccgcagttaacggcgccgcc
atcggcggcgggttatgtctggccctggccgccgacatccgggttgcctcgaccagcgcc
tacttccgggccgccggcatcaacaacgggctgaccgcaagcgaattgggcctgagctat
ctgctgccccgggccatcggctcctcgcgagcgttcgagctgatgctgaccggtcgcgac
gtcgacgccgaagaagccgaacgcatcgggctggtgtcgtatcgcgtgcccgacgagcag
ctgctggacacgtgctatgcgctggccgaacggatcgcggcgttctcgcgtcccggaatc
gagttgaccaagcgcacactgtggagtggactggacgccgctagcctggaagggcacatg
caggccgagggtctcggacagctgttcgttcgtctgctcacctccaacttcgaggaagcg
gttgccgcgcgggctgagaaacggcctccggtgttcaccgacgacacgtga

KEGG   Mycobacterium noviomagense: MNVI_41780
Entry
MNVI_41780        CDS       T06809                                 

Gene name
echA19_2
Definition
(GenBank) enoyl-CoA hydratase
  KO
K01692  enoyl-CoA hydratase [EC:4.2.1.17]
Organism
mnv  Mycobacterium noviomagense
Pathway
mnv00071  Fatty acid degradation
mnv00280  Valine, leucine and isoleucine degradation
mnv00281  Geraniol degradation
mnv00310  Lysine degradation
mnv00360  Phenylalanine metabolism
mnv00362  Benzoate degradation
mnv00380  Tryptophan metabolism
mnv00410  beta-Alanine metabolism
mnv00627  Aminobenzoate degradation
mnv00640  Propanoate metabolism
mnv00650  Butanoate metabolism
mnv00903  Limonene and pinene degradation
mnv00930  Caprolactam degradation
mnv01100  Metabolic pathways
mnv01110  Biosynthesis of secondary metabolites
mnv01120  Microbial metabolism in diverse environments
mnv01212  Fatty acid metabolism
Module
mnv_M00087  beta-Oxidation
Brite
KEGG Orthology (KO) [BR:mnv00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00640 Propanoate metabolism
    MNVI_41780 (echA19_2)
   00650 Butanoate metabolism
    MNVI_41780 (echA19_2)
  09103 Lipid metabolism
   00071 Fatty acid degradation
    MNVI_41780 (echA19_2)
  09105 Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    MNVI_41780 (echA19_2)
   00310 Lysine degradation
    MNVI_41780 (echA19_2)
   00360 Phenylalanine metabolism
    MNVI_41780 (echA19_2)
   00380 Tryptophan metabolism
    MNVI_41780 (echA19_2)
  09106 Metabolism of other amino acids
   00410 beta-Alanine metabolism
    MNVI_41780 (echA19_2)
  09109 Metabolism of terpenoids and polyketides
   00903 Limonene and pinene degradation
    MNVI_41780 (echA19_2)
   00281 Geraniol degradation
    MNVI_41780 (echA19_2)
  09111 Xenobiotics biodegradation and metabolism
   00362 Benzoate degradation
    MNVI_41780 (echA19_2)
   00627 Aminobenzoate degradation
    MNVI_41780 (echA19_2)
   00930 Caprolactam degradation
    MNVI_41780 (echA19_2)
Enzymes [BR:mnv01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.17  enoyl-CoA hydratase
     MNVI_41780 (echA19_2)
SSDB
Motif
Pfam: ECH_1 ECH_2 Gemini_AC4_5_2
Other DBs
NCBI-ProteinID: BBY08860
UniProt: A0A7I7PK06
Position
complement(4372259..4373083)
AA seq 274 aa
MIRATIATAELRDAVSIDYARDAHIVTITINRPETRNSLDMEHFRDLARAWAAFRDDPDA
WVAVITGVGRDFCTGADLKKFIPELTGDLPQPDGWDKTDAIHAVLHRFPVHKPIVAAVNG
TCVAGGLEMLGGTDIRVAVPDARFGVLEPKRGLFAGGGSTVRLPRQMPYAFAMELLLTAD
MVDADRALAMGLINKVVANDQLMDTAYDYAGRIAANAPLAVSATKQSAVEGLALDLESAY
DNETRHSDRVFASEDAKEGPRAFAQKRPPQWRAR
NT seq 825 nt   +upstreamnt  +downstreamnt
atgattcgcgcaacgatcgcgacggcggagctgagggacgcagtgagtatcgactacgcg
cgggacgcccatatcgtcaccatcacgatcaaccgtcccgagacccgtaactcgctcgac
atggagcatttccgggacctggcccgcgcctgggcggcttttcgtgacgaccccgacgca
tgggtggccgttatcaccggcgtcggccgcgacttctgcaccggagccgacctgaagaag
ttcatcccggaattgaccggtgacctaccgcaacccgacggatgggataaaaccgacgcg
atccatgccgtcttgcacaggttcccggtgcacaagccaatcgtcgcagcggtgaacggg
acgtgcgtcgcgggcggcttggagatgttgggcggcacggacattcgcgtcgcggtgccc
gatgcacggttcggcgtgctagaacccaagcgcggactgttcgccggcggcggcagcacg
gtgcggctgccgcggcagatgccctatgcattcgcgatggagctgctgctgaccgctgac
atggtggacgccgaccgtgcgctggcgatgggactgatcaacaaggtcgtggcaaacgat
caattgatggacaccgcctacgactacgccgggcgcatcgcggccaatgcgccgctcgcc
gtgtctgcgaccaaacagtccgccgtcgaggggctggcgctcgacttggaatccgcgtac
gacaacgaaactcggcacagtgaccgtgttttcgcgagcgaggacgccaaggaaggtccg
cgcgccttcgcgcagaagcgaccaccgcaatggcgggcacgctga

KEGG   Mycobacterium noviomagense: MNVI_45510
Entry
MNVI_45510        CDS       T06809                                 

Definition
(GenBank) enoyl-CoA hydratase
  KO
K01692  enoyl-CoA hydratase [EC:4.2.1.17]
Organism
mnv  Mycobacterium noviomagense
Pathway
mnv00071  Fatty acid degradation
mnv00280  Valine, leucine and isoleucine degradation
mnv00281  Geraniol degradation
mnv00310  Lysine degradation
mnv00360  Phenylalanine metabolism
mnv00362  Benzoate degradation
mnv00380  Tryptophan metabolism
mnv00410  beta-Alanine metabolism
mnv00627  Aminobenzoate degradation
mnv00640  Propanoate metabolism
mnv00650  Butanoate metabolism
mnv00903  Limonene and pinene degradation
mnv00930  Caprolactam degradation
mnv01100  Metabolic pathways
mnv01110  Biosynthesis of secondary metabolites
mnv01120  Microbial metabolism in diverse environments
mnv01212  Fatty acid metabolism
Module
mnv_M00087  beta-Oxidation
Brite
KEGG Orthology (KO) [BR:mnv00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00640 Propanoate metabolism
    MNVI_45510
   00650 Butanoate metabolism
    MNVI_45510
  09103 Lipid metabolism
   00071 Fatty acid degradation
    MNVI_45510
  09105 Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    MNVI_45510
   00310 Lysine degradation
    MNVI_45510
   00360 Phenylalanine metabolism
    MNVI_45510
   00380 Tryptophan metabolism
    MNVI_45510
  09106 Metabolism of other amino acids
   00410 beta-Alanine metabolism
    MNVI_45510
  09109 Metabolism of terpenoids and polyketides
   00903 Limonene and pinene degradation
    MNVI_45510
   00281 Geraniol degradation
    MNVI_45510
  09111 Xenobiotics biodegradation and metabolism
   00362 Benzoate degradation
    MNVI_45510
   00627 Aminobenzoate degradation
    MNVI_45510
   00930 Caprolactam degradation
    MNVI_45510
Enzymes [BR:mnv01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.17  enoyl-CoA hydratase
     MNVI_45510
SSDB
Motif
Pfam: ECH_1 ECH_2
Other DBs
NCBI-ProteinID: BBY09233
UniProt: A0A7I7PKR7
Position
4746341..4747312
AA seq 323 aa
MPEYDYVQMKKDAEPFIKFEKDVKNRIAYITFDRPDAQNATTLGMRQNYADLIHKCNVDD
EVKVVVIRGEGEDFGSGGDLPEQRGMLENPGMPLLHELAINDDDVKYPPGGSYRYLSTVT
DFYAKARAGNRPLQELRKISIIEAKGYCYGWHFYQAGDADLVVSSDDALFGHPAFRYVGW
GPRLWWWAETMGLRKFSEMLFTGRPFTAKEMYECGFVNSVVPREKLEEETLKYAMACSRS
RPTDTVAVQKTFLELYKQHKGEYFGSLLTGLVEGMLPMIQNDRDNEVDLTEGTFGKGLNN
VVKDNDTNFPPEWRLSRSGRAKP
NT seq 972 nt   +upstreamnt  +downstreamnt
atgcctgaatacgactacgtccaaatgaagaaagacgccgagccgttcatcaagttcgaa
aaggacgtcaagaaccggatcgcgtatatcactttcgaccgtccggacgcgcagaacgcc
accaccttaggtatgcggcagaactatgcggacctgatccataaatgcaacgtcgacgac
gaggtcaaggttgtcgtgatccgcggcgagggcgaggatttcggaagcgggggcgatctg
cccgaacaacgcggcatgctggaaaaccccggcatgccgctgctgcatgagctcgccatc
aacgacgacgacgtcaagtacccgccgggcggctcataccgttacctgtcgacggtcacc
gacttctatgcgaaggcccgcgccggcaaccggccacttcaagaactgcgcaaaatcagc
attatcgaggccaaaggctactgctacggctggcacttctaccaggccggcgacgccgac
ctcgtcgtctcctccgacgatgccctgttcggccaccccgccttccgctacgtgggttgg
ggcccccggctgtggtggtgggcggagaccatgggcttgcgcaagttctccgaaatgctc
ttcaccgggcggcctttcacggccaaggagatgtacgagtgcggcttcgtcaacagtgtc
gtcccacgcgagaagctcgaggaggagaccctgaaatacgcgatggcgtgttcgcggtcc
cggcccaccgacaccgtcgcggtgcagaagacattcctggagctctacaagcagcacaag
ggcgagtacttcggcagcctgctcaccggtctggttgaaggcatgctgccgatgatccaa
aacgaccgcgacaacgaggtcgacctgaccgaaggcacgttcggcaagggcctgaacaac
gttgtgaaggacaacgatacgaacttcccgcccgagtggcggctcagccgctcgggacgc
gccaagccctga

DBGET integrated database retrieval system