KEGG   Mycobacterium noviomagense: MNVI_02420
Entry
MNVI_02420        CDS       T06809                                 

Definition
(GenBank) aldehyde dehydrogenase
  KO
K00128  aldehyde dehydrogenase (NAD+) [EC:1.2.1.3]
Organism
mnv  Mycobacterium noviomagense
Pathway
mnv00010  Glycolysis / Gluconeogenesis
mnv00053  Ascorbate and aldarate metabolism
mnv00071  Fatty acid degradation
mnv00280  Valine, leucine and isoleucine degradation
mnv00310  Lysine degradation
mnv00330  Arginine and proline metabolism
mnv00340  Histidine metabolism
mnv00380  Tryptophan metabolism
mnv00410  beta-Alanine metabolism
mnv00561  Glycerolipid metabolism
mnv00620  Pyruvate metabolism
mnv00625  Chloroalkane and chloroalkene degradation
mnv00770  Pantothenate and CoA biosynthesis
mnv00903  Limonene and pinene degradation
mnv01100  Metabolic pathways
mnv01110  Biosynthesis of secondary metabolites
mnv01120  Microbial metabolism in diverse environments
mnv01240  Biosynthesis of cofactors
Brite
KEGG Orthology (KO) [BR:mnv00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    MNVI_02420
   00053 Ascorbate and aldarate metabolism
    MNVI_02420
   00620 Pyruvate metabolism
    MNVI_02420
  09103 Lipid metabolism
   00071 Fatty acid degradation
    MNVI_02420
   00561 Glycerolipid metabolism
    MNVI_02420
  09105 Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    MNVI_02420
   00310 Lysine degradation
    MNVI_02420
   00330 Arginine and proline metabolism
    MNVI_02420
   00340 Histidine metabolism
    MNVI_02420
   00380 Tryptophan metabolism
    MNVI_02420
  09106 Metabolism of other amino acids
   00410 beta-Alanine metabolism
    MNVI_02420
  09108 Metabolism of cofactors and vitamins
   00770 Pantothenate and CoA biosynthesis
    MNVI_02420
  09109 Metabolism of terpenoids and polyketides
   00903 Limonene and pinene degradation
    MNVI_02420
  09111 Xenobiotics biodegradation and metabolism
   00625 Chloroalkane and chloroalkene degradation
    MNVI_02420
Enzymes [BR:mnv01000]
 1. Oxidoreductases
  1.2  Acting on the aldehyde or oxo group of donors
   1.2.1  With NAD+ or NADP+ as acceptor
    1.2.1.3  aldehyde dehydrogenase (NAD+)
     MNVI_02420
SSDB
Motif
Pfam: Aldedh LuxC DJ-1_PfpI
Other DBs
NCBI-ProteinID: BBY04924
UniProt: A0A7I7P8D1
Position
306800..308281
AA seq 493 aa
MTDPAHRFYDELFIGGRWRKPATERRLVVISPHSEQPVGEVPEAGPEDVNAAVRAARQAF
DDGPWPRLEPRERMEKIDKLAAIYAGHIDEMADLITAEMGSPRSFSRLGQAAGAAHMMQL
ALATGREFRWEERRRGVLGEGHLRKAPVGVVGAIVPWNVPQFLIMPKLIPALIAGCTVVV
KPAPETPLDALWLAEMLEEIDLPEGVVSILPGGRDVGECLVRHPGVDKVAFTGSSATGRR
IAAICGGQLKRVSLELGGKSAAIILDDADIDKTVTGLKTAGLMNNGQACVAQTRILVSER
RHDEVVDALAAMMSGLRVGDPADEATDIGPLVAQRQQRRVQDYIRCGVAEGARTVLGGDG
PPMDRGWYVRPTLFTDATNDMRIAREEIFGPVLTVLTYKDEQDAVRIANDSDYGLAGSVW
TADVAHGLEIAAGVRTGTYGINMYMLDIGTPFGGFKQSGIGREFGPEGLSEYVELQAVVS
NGALPPLKGTAPG
NT seq 1482 nt   +upstreamnt  +downstreamnt
atgaccgatcccgcccaccggttctatgacgaactgttcatcggtggacgctggcgcaaa
cccgccaccgagcgccgtctcgtggtcatttcaccgcattccgagcagccggtcggcgag
gttccggaggccgggcccgaggacgtcaacgccgcggtacgcgccgcgcgacaggctttc
gacgacggtccctggccgcggttggagccacgcgagcgcatggagaagatcgacaagctg
gccgcgatctatgccggccacatcgacgagatggccgacctgatcaccgcggaaatgggc
tctccgcgcagcttttcgagactgggtcaggccgctggcgcggcccacatgatgcagctg
gcgctggccaccgggcgggagttccgttgggaggagcgccgccgaggtgtgctcggcgag
ggtcacctacgcaaggcgccggtcggcgtggtgggcgcgatcgtgccgtggaacgtgccg
caattcctcatcatgccgaagctgatcccggcgctgatcgccggctgcactgtggtcgtc
aagcccgcccccgaaacccctttggatgctttgtggttggccgagatgctggaggagatc
gacctgcccgaaggcgtggtgtcgatccttcccggcggccgcgacgtcggagagtgcctg
gttcggcatcccggtgtggacaaggttgccttcaccggttccagcgccaccgggcggcgg
atcgccgccatctgcggtgggcagctcaagcgggtgagcttagagctgggtggcaagtcg
gcggcgatcattctcgacgacgccgacatcgacaagaccgtcaccgggttgaagacggcc
ggtctgatgaacaacgggcaggcctgcgtggcgcaaacccgcatcctggtcagcgaacgc
cgtcacgacgaggtcgtcgacgcgctcgccgccatgatgtctggcctgcgtgtcggtgat
cccgccgacgaggcgaccgacatcggaccccttgtggcccaacgccaacaacgccgggtg
caggactacatccgctgcggggtggccgagggtgctcgcacggtgctgggcggcgacgga
ccgcctatggaccgcggctggtatgtgcggccgacgctgttcaccgatgccaccaacgac
atgcgcatcgcacgcgaagagatcttcggccctgtacttaccgtgctcacctacaaagac
gagcaggacgcggttcgcatcgccaacgacagcgactacggcttggccggatcggtgtgg
acggccgacgtcgcgcacggcctcgagatcgcggccggtgtgcgcaccggcacgtacggc
atcaacatgtacatgctcgatatcggaacgccgttcggcggtttcaagcagtcaggtatc
ggccgcgagttcggcccggagggcctgagcgaatacgtcgagctgcaagcggtcgtcagc
aacggcgcgctgccgccacttaaaggaacagctccagggtga

KEGG   Mycobacterium noviomagense: MNVI_09420
Entry
MNVI_09420        CDS       T06809                                 

Definition
(GenBank) aldehyde dehydrogenase
  KO
K00128  aldehyde dehydrogenase (NAD+) [EC:1.2.1.3]
Organism
mnv  Mycobacterium noviomagense
Pathway
mnv00010  Glycolysis / Gluconeogenesis
mnv00053  Ascorbate and aldarate metabolism
mnv00071  Fatty acid degradation
mnv00280  Valine, leucine and isoleucine degradation
mnv00310  Lysine degradation
mnv00330  Arginine and proline metabolism
mnv00340  Histidine metabolism
mnv00380  Tryptophan metabolism
mnv00410  beta-Alanine metabolism
mnv00561  Glycerolipid metabolism
mnv00620  Pyruvate metabolism
mnv00625  Chloroalkane and chloroalkene degradation
mnv00770  Pantothenate and CoA biosynthesis
mnv00903  Limonene and pinene degradation
mnv01100  Metabolic pathways
mnv01110  Biosynthesis of secondary metabolites
mnv01120  Microbial metabolism in diverse environments
mnv01240  Biosynthesis of cofactors
Brite
KEGG Orthology (KO) [BR:mnv00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    MNVI_09420
   00053 Ascorbate and aldarate metabolism
    MNVI_09420
   00620 Pyruvate metabolism
    MNVI_09420
  09103 Lipid metabolism
   00071 Fatty acid degradation
    MNVI_09420
   00561 Glycerolipid metabolism
    MNVI_09420
  09105 Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    MNVI_09420
   00310 Lysine degradation
    MNVI_09420
   00330 Arginine and proline metabolism
    MNVI_09420
   00340 Histidine metabolism
    MNVI_09420
   00380 Tryptophan metabolism
    MNVI_09420
  09106 Metabolism of other amino acids
   00410 beta-Alanine metabolism
    MNVI_09420
  09108 Metabolism of cofactors and vitamins
   00770 Pantothenate and CoA biosynthesis
    MNVI_09420
  09109 Metabolism of terpenoids and polyketides
   00903 Limonene and pinene degradation
    MNVI_09420
  09111 Xenobiotics biodegradation and metabolism
   00625 Chloroalkane and chloroalkene degradation
    MNVI_09420
Enzymes [BR:mnv01000]
 1. Oxidoreductases
  1.2  Acting on the aldehyde or oxo group of donors
   1.2.1  With NAD+ or NADP+ as acceptor
    1.2.1.3  aldehyde dehydrogenase (NAD+)
     MNVI_09420
SSDB
Motif
Pfam: Aldedh
Other DBs
NCBI-ProteinID: BBY05624
UniProt: A0A7I7PAM6
Position
complement(1020973..1022490)
AA seq 505 aa
MTIAAGGGSSGGASGAQVPDDMRADRRLLIDGRLVTSKRTFPSVNPATGEVLGYAPDAGL
AEAEAAIAAARRAFDTTSWPTDVEFRVHCLEQLHHALLEQAEELRELTIAEVGATRALTH
GPQLDEPIGIVRYYADLLRTYPMSEDLGEMESRGMRHHRWVEKEAAGVVGAIIAYNYPNQ
LALAKLAPALAAGCTVVLKGAPDTPLITLALGELIANHTDIPAGVLNVLSSSDPAVGAAL
TTSRDVDVITFTGSTATGRKIMAAAAETVKRVFLELGGKSAVIMLDDADFSMASMFAAFS
MCSHAGQGCALTSRLLVPRKRHEEIVELIAQNFAKVRHGDPADPNTYMGPLINERQRDKV
DGMVQRAVAAGATLVTGGKKIDPGFFYAPTLLTNVDPDSEIAQEEVFGPVLVVIPFTDDD
DAVRIANNSIYGLSGSVFGSQHRALSVARRVRTGTLSINGGNYFAPDAPFGGFKQSGVGR
EMGVAGLEEFLERKTLALPGAAVAG
NT seq 1518 nt   +upstreamnt  +downstreamnt
gtgaccatcgcggcaggtggcgggtcctcgggcggcgcatcgggggctcaagtcccggat
gacatgcgggccgaccggcgcctgctgattgacggccggcttgtcacttcaaagcggaca
tttccttcggtcaatccggcgacgggcgaagtcctcgggtacgccccggacgcaggcctc
gccgaagcggaagcggccatcgcggctgcgcggcgcgcattcgacaccaccagctggccg
accgacgtcgaattccgggtccactgcctcgagcagctgcatcacgcgctgctcgagcag
gccgaggaactgcgcgaactgacgattgccgaagtcggcgccactcgggcgctgacccac
gggcctcagctcgacgagccgatcgggattgtccgctactacgccgacctgctgcgtacc
tatccgatgagcgaggatctcggcgagatggaatcgcgcggtatgcgccatcaccgctgg
gtagagaaggaagccgccggggtggtaggtgccatcattgcctacaactatcccaaccag
ctggcgctggccaagctggctcccgccctggccgccggatgcacggtcgtgctcaagggc
gcgccggacacgccgctgattacgctggcgctgggcgagctgatcgccaaccacaccgat
atcccggccggcgtactgaatgtgctgagctcgtcggatccagcggtcggcgccgcgctg
accacgagccgtgacgtcgacgtcatcaccttcaccgggtcgaccgccaccggccgcaag
atcatggccgcggccgccgaaacggtgaagcgggtcttcctcgagctgggcggcaagtcg
gcggtgatcatgctcgacgacgccgacttttcgatggcgagcatgttcgcggccttctcc
atgtgcagccatgcggggcaaggttgcgcgttgacgtcccggttgctggtgcccaggaag
cgccacgaggagatcgtcgagctgatcgcacagaatttcgcgaaggtgcgtcacggtgat
ccggccgaccccaatacctatatgggcccgttgatcaacgagcgccagcgcgacaaggtc
gacgggatggtccagcgcgccgtcgcggccggcgcgaccctggtgacgggcggcaaaaag
atcgaccccggtttcttttatgccccaactctgctgaccaacgtcgatccggacagcgag
atcgcccaggaggaggtcttcgggccggtgctggtggtcattccgttcactgatgacgac
gacgccgtgcgcatcgcaaacaactcgatctacgggctttcgggttcggtgttcggcagc
cagcaccgggcgctctcggtggcgcgccgggtccgcaccggcacgctgtccatcaacggc
ggcaactacttcgcgccggacgccccattcggaggcttcaagcaatccggagtcggccgc
gaaatgggcgtcgccgggctcgaagaattcctggagcgcaagacgctggctctgcctggg
gcggcggtggccggatga

KEGG   Mycobacterium noviomagense: MNVI_11260
Entry
MNVI_11260        CDS       T06809                                 

Gene name
aldA
Definition
(GenBank) aldehyde dehydrogenase
  KO
K00128  aldehyde dehydrogenase (NAD+) [EC:1.2.1.3]
Organism
mnv  Mycobacterium noviomagense
Pathway
mnv00010  Glycolysis / Gluconeogenesis
mnv00053  Ascorbate and aldarate metabolism
mnv00071  Fatty acid degradation
mnv00280  Valine, leucine and isoleucine degradation
mnv00310  Lysine degradation
mnv00330  Arginine and proline metabolism
mnv00340  Histidine metabolism
mnv00380  Tryptophan metabolism
mnv00410  beta-Alanine metabolism
mnv00561  Glycerolipid metabolism
mnv00620  Pyruvate metabolism
mnv00625  Chloroalkane and chloroalkene degradation
mnv00770  Pantothenate and CoA biosynthesis
mnv00903  Limonene and pinene degradation
mnv01100  Metabolic pathways
mnv01110  Biosynthesis of secondary metabolites
mnv01120  Microbial metabolism in diverse environments
mnv01240  Biosynthesis of cofactors
Brite
KEGG Orthology (KO) [BR:mnv00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    MNVI_11260 (aldA)
   00053 Ascorbate and aldarate metabolism
    MNVI_11260 (aldA)
   00620 Pyruvate metabolism
    MNVI_11260 (aldA)
  09103 Lipid metabolism
   00071 Fatty acid degradation
    MNVI_11260 (aldA)
   00561 Glycerolipid metabolism
    MNVI_11260 (aldA)
  09105 Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    MNVI_11260 (aldA)
   00310 Lysine degradation
    MNVI_11260 (aldA)
   00330 Arginine and proline metabolism
    MNVI_11260 (aldA)
   00340 Histidine metabolism
    MNVI_11260 (aldA)
   00380 Tryptophan metabolism
    MNVI_11260 (aldA)
  09106 Metabolism of other amino acids
   00410 beta-Alanine metabolism
    MNVI_11260 (aldA)
  09108 Metabolism of cofactors and vitamins
   00770 Pantothenate and CoA biosynthesis
    MNVI_11260 (aldA)
  09109 Metabolism of terpenoids and polyketides
   00903 Limonene and pinene degradation
    MNVI_11260 (aldA)
  09111 Xenobiotics biodegradation and metabolism
   00625 Chloroalkane and chloroalkene degradation
    MNVI_11260 (aldA)
Enzymes [BR:mnv01000]
 1. Oxidoreductases
  1.2  Acting on the aldehyde or oxo group of donors
   1.2.1  With NAD+ or NADP+ as acceptor
    1.2.1.3  aldehyde dehydrogenase (NAD+)
     MNVI_11260 (aldA)
SSDB
Motif
Pfam: Aldedh
Other DBs
NCBI-ProteinID: BBY05808
UniProt: A0A7I7PB55
Position
complement(1192603..1194069)
AA seq 488 aa
MALLADGVSAVLIDGKLSAGSAGTFPTINPATEEVLGGAADASAEDMSRAIDAARRAFDE
TNWSRNTELRVRCVRQLRDALRSHVEELREITIAEVGAPRMLTASAQLEGPINDLAFSAD
TAEAYQWNQDLGEAAPLGIPTRRTIAREAVGVVGAITPWNFPHQINLAKLGPALAAGNTV
VLKPAPDTPWCAGVLAEIIVEHTDFPPGVVNIVTSSDHSLGALLAKDPRVDMISFTGSTA
TGRSVMADAAANIKKVFLELGGKSAFVVLDDADMAGACSVSAFAASMHAGQGCAITTRLV
VPRARYDEAVEIAAATMGSIKPGDPNDPGTVCGPLISARQRDRVQGYLDLAVAEGGSFAC
GGGRPADKASGFFIEPTVIVGLTNDARPAREEIFGPVLTVIAHDGDDDAVRIANDSPYGL
SGTVYSGDAERAANVAARLRVGTVNVNGGVWYSADAPFGGYKQSGIGREMGLAGFEEYLE
TKVVATAI
NT seq 1467 nt   +upstreamnt  +downstreamnt
atggcgttgttggcagatggggtaagtgccgtactcatcgacggcaaactctcggccggc
agcgccggaacgttcccgaccatcaatccggcgaccgaggaagtgctcggcggcgccgcc
gacgccagcgccgaggacatgagccgcgccatcgacgcggcgcggcgggccttcgacgaa
accaactggtcacgtaacaccgagctgcgggtgcgatgtgtgcgccagctgcgcgacgca
ctgcgctcgcatgtggaggagctccgcgagatcaccatcgccgaggtcggcgcgccgcgg
atgctcaccgccagcgctcagctcgagggtcccatcaacgacctggctttctccgcggac
accgccgaggcataccagtggaaccaggatctcggtgaggctgcgccgctgggcatcccg
acccggcgcaccatcgcacgcgaagccgtcggcgtggtcggggcaatcaccccgtggaac
ttcccgcaccagatcaacctggccaagctagggccggcgttggcggcgggcaacaccgtc
gtcctcaaaccggcacccgacacaccgtggtgcgcgggcgtgctcgccgagatcattgtc
gagcacaccgattttccgcccggcgtggtcaatatcgtcacctccagcgatcacagcttg
ggggcgttgctggccaaagaccctcgggtggacatgatttcgttcaccggatcgaccgcc
accggccgcagcgtgatggccgacgccgccgccaacatcaagaaagtgtttttggaactg
ggcggcaagtcggcgttcgtggtgctcgacgacgccgatatggcgggcgcctgttcggtg
tcggcgttcgcggcctccatgcacgccggtcagggttgcgcgatcaccacccggctggtg
gtgccgcgggcccgctacgacgaggcggtggaaattgcggccgccacgatgggttcgatc
aaacccggcgacccgaacgatcccggcacggtgtgcgggccgctgatctcggcgcggcag
cgtgatcgggtgcagggatacctggatctggctgtggcagaaggtggttcgttcgcctgc
ggcggcggccggccggcggacaaggcgagcggatttttcatcgagccgacggtgatcgtc
gggctcaccaacgacgcccggcctgcccgcgaggagattttcggcccggtgctcacggtg
atcgcccatgacggcgacgacgacgcggtgcgcatcgccaacgattcgccatacggcttg
tccgggaccgtctacagtggcgatgcggaacgcgcggccaacgtcgcggcgcggctgcgg
gtcggcaccgtcaacgtcaacggcggcgtgtggtactccgccgatgcgccattcggcggt
tacaagcaatccggcatcggccgcgagatggggctggccgggttcgaggagtacctcgag
accaaagtcgttgccacagcgatttag

KEGG   Mycobacterium noviomagense: MNVI_17930
Entry
MNVI_17930        CDS       T06809                                 

Definition
(GenBank) aldehyde dehydrogenase
  KO
K00128  aldehyde dehydrogenase (NAD+) [EC:1.2.1.3]
Organism
mnv  Mycobacterium noviomagense
Pathway
mnv00010  Glycolysis / Gluconeogenesis
mnv00053  Ascorbate and aldarate metabolism
mnv00071  Fatty acid degradation
mnv00280  Valine, leucine and isoleucine degradation
mnv00310  Lysine degradation
mnv00330  Arginine and proline metabolism
mnv00340  Histidine metabolism
mnv00380  Tryptophan metabolism
mnv00410  beta-Alanine metabolism
mnv00561  Glycerolipid metabolism
mnv00620  Pyruvate metabolism
mnv00625  Chloroalkane and chloroalkene degradation
mnv00770  Pantothenate and CoA biosynthesis
mnv00903  Limonene and pinene degradation
mnv01100  Metabolic pathways
mnv01110  Biosynthesis of secondary metabolites
mnv01120  Microbial metabolism in diverse environments
mnv01240  Biosynthesis of cofactors
Brite
KEGG Orthology (KO) [BR:mnv00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    MNVI_17930
   00053 Ascorbate and aldarate metabolism
    MNVI_17930
   00620 Pyruvate metabolism
    MNVI_17930
  09103 Lipid metabolism
   00071 Fatty acid degradation
    MNVI_17930
   00561 Glycerolipid metabolism
    MNVI_17930
  09105 Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    MNVI_17930
   00310 Lysine degradation
    MNVI_17930
   00330 Arginine and proline metabolism
    MNVI_17930
   00340 Histidine metabolism
    MNVI_17930
   00380 Tryptophan metabolism
    MNVI_17930
  09106 Metabolism of other amino acids
   00410 beta-Alanine metabolism
    MNVI_17930
  09108 Metabolism of cofactors and vitamins
   00770 Pantothenate and CoA biosynthesis
    MNVI_17930
  09109 Metabolism of terpenoids and polyketides
   00903 Limonene and pinene degradation
    MNVI_17930
  09111 Xenobiotics biodegradation and metabolism
   00625 Chloroalkane and chloroalkene degradation
    MNVI_17930
Enzymes [BR:mnv01000]
 1. Oxidoreductases
  1.2  Acting on the aldehyde or oxo group of donors
   1.2.1  With NAD+ or NADP+ as acceptor
    1.2.1.3  aldehyde dehydrogenase (NAD+)
     MNVI_17930
SSDB
Motif
Pfam: Aldedh
Other DBs
NCBI-ProteinID: BBY06475
UniProt: A0A7I7PD94
Position
1945882..1947318
AA seq 478 aa
MREYVKFYIDGQWVDPVRPNPFDIENPATQQITGKISLGSAADVDVAVNAARRAFATWSQ
SSREERLDLLQAILAEYQRRADDLAGAVTEEMGAPPSLAAGPQVQLGLGHLMTAIDVLKN
FSFEEQHGATLVVKEPIGVCGLITPWNWPLNQIAVKVYPALATGCTMILKPSEVAPYSAY
IFTEILDAAGVPAGVYNLVNGDGPGVGVALSRHPDIDMVSFTGSTRAGIDVAANAAPTVK
RVTQELGGKSPNIVLDDAEFENSVRAGVVNMMLNTGQSCNAPSRMLVPKSRMAEAVAIAR
EAAEQVKVGDPDDSRAIGPLASRAQFDKVQRLIQKGIDEGAMLVTGGTGRPDGLDTGYYV
KPTVFADVTNDMTIAREEIFGPVLCMIGYDDIDHAIEIANDTDYGLAGYVSGADLDKART
VARRIRAGWVTINHAFDMNAPFGGYKGSGNGREWSEFGFHEYLEIKSVLGHAPEKAAG
NT seq 1437 nt   +upstreamnt  +downstreamnt
atgcgcgaatatgtgaagttctacatcgatggtcagtgggtcgatcccgtgcgacctaac
cctttcgacatcgaaaatcccgctactcaacagatcaccggcaaaatctcacttggttcg
gccgccgacgtcgacgtggcggtgaatgcggcccgaagggcgttcgccacatggtcgcaa
agcagccgcgaagagcgccttgatcttctgcaagcgattctcgcggaataccaaagacgc
gctgacgaccttgcaggagcagtgacggaggagatgggtgcgccgccatcgttggccgct
gggccgcaggtgcagctcggcctcggtcacctgatgactgccatagatgtgctgaagaac
ttttcgttcgaggaacagcacggtgcaaccctggtggtcaaggagccgatcggggtatgc
gggctgatcacaccgtggaactggccgctcaaccagatcgcagtcaaggtgtacccggca
ctggcgaccggctgcacgatgatcttgaagccttcggaggttgcgccctactcggcatac
atcttcaccgaaatcctcgatgccgcaggcgttccagcaggggtatacaacctggtcaat
ggcgacggcccgggcgtgggggtggcgctgtcccgtcaccccgacatcgacatggtttcg
tttaccggttccacccgcgccggcatcgacgtggctgcaaacgccgccccgacggtgaag
cgagtgacccaggaactggggggcaagagcccgaacatcgtcctggacgatgcggaattc
gagaacagcgtccgtgccggcgtggtcaacatgatgctgaacaccggccagagctgtaac
gcgccgtcgcgcatgctggtgcctaaatcacgcatggccgaagcggtcgcaattgcccgc
gaagccgccgaacaggtgaaggtcggcgaccccgatgacagccgtgcaatcggaccgctt
gcctcaagagcgcagttcgacaaggttcagcgcttgatccaaaagggtatcgacgagggc
gccatgctggtcaccggcggcaccggccggccagatggactggacaccggctactacgtc
aagcccaccgtctttgccgacgtcaccaatgacatgaccatcgcccgcgaggaaatcttc
gggccggtgctgtgcatgatcggttacgacgacatcgaccacgcgatcgaaattgccaac
gacacagactacggtctggccggatacgtttcgggagccgacctcgacaaggcgcgcacc
gttgcgcgccggatccgtgctggctgggtgacaatcaaccacgccttcgacatgaacgcg
cctttcggcggctacaagggaagcggcaacggtcgcgaatggagtgagttcggcttccac
gagtacttggagatcaaaagcgtccttggccacgcgcccgaaaaggcggcaggttag

KEGG   Mycobacterium noviomagense: MNVI_18500
Entry
MNVI_18500        CDS       T06809                                 

Definition
(GenBank) aldehyde dehydrogenase
  KO
K00128  aldehyde dehydrogenase (NAD+) [EC:1.2.1.3]
Organism
mnv  Mycobacterium noviomagense
Pathway
mnv00010  Glycolysis / Gluconeogenesis
mnv00053  Ascorbate and aldarate metabolism
mnv00071  Fatty acid degradation
mnv00280  Valine, leucine and isoleucine degradation
mnv00310  Lysine degradation
mnv00330  Arginine and proline metabolism
mnv00340  Histidine metabolism
mnv00380  Tryptophan metabolism
mnv00410  beta-Alanine metabolism
mnv00561  Glycerolipid metabolism
mnv00620  Pyruvate metabolism
mnv00625  Chloroalkane and chloroalkene degradation
mnv00770  Pantothenate and CoA biosynthesis
mnv00903  Limonene and pinene degradation
mnv01100  Metabolic pathways
mnv01110  Biosynthesis of secondary metabolites
mnv01120  Microbial metabolism in diverse environments
mnv01240  Biosynthesis of cofactors
Brite
KEGG Orthology (KO) [BR:mnv00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    MNVI_18500
   00053 Ascorbate and aldarate metabolism
    MNVI_18500
   00620 Pyruvate metabolism
    MNVI_18500
  09103 Lipid metabolism
   00071 Fatty acid degradation
    MNVI_18500
   00561 Glycerolipid metabolism
    MNVI_18500
  09105 Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    MNVI_18500
   00310 Lysine degradation
    MNVI_18500
   00330 Arginine and proline metabolism
    MNVI_18500
   00340 Histidine metabolism
    MNVI_18500
   00380 Tryptophan metabolism
    MNVI_18500
  09106 Metabolism of other amino acids
   00410 beta-Alanine metabolism
    MNVI_18500
  09108 Metabolism of cofactors and vitamins
   00770 Pantothenate and CoA biosynthesis
    MNVI_18500
  09109 Metabolism of terpenoids and polyketides
   00903 Limonene and pinene degradation
    MNVI_18500
  09111 Xenobiotics biodegradation and metabolism
   00625 Chloroalkane and chloroalkene degradation
    MNVI_18500
Enzymes [BR:mnv01000]
 1. Oxidoreductases
  1.2  Acting on the aldehyde or oxo group of donors
   1.2.1  With NAD+ or NADP+ as acceptor
    1.2.1.3  aldehyde dehydrogenase (NAD+)
     MNVI_18500
SSDB
Motif
Pfam: Aldedh DRTGG
Other DBs
NCBI-ProteinID: BBY06532
UniProt: A0A7I7PD88
Position
1996072..1997490
AA seq 472 aa
MTSEAAAQPSPDTAASARTDIPQTVAHLRETFATGRSRSLEWRRTQLRAIEKMMAENETK
IAEALQADLCRKPFEAWMADIAGTAAEARYAAKHVGSWMRRKYRLLERAQLPGLGWVEYE
PYGTVLIIGAWNYPFVLTLGPAIGAIAAGNTMVLKPSEVTPASSRLIAELVPRYLDGEAI
AVVEGDAAVSQQLIAQGFDRVVFTGGTEIGRKVYEAAAPHLTPVTLELGGKSPVIVAADA
DVDVAAKRIAWIKLLNSGQTCIAPDYVLADARIRDELVTKIGEAITTFGSDEPAGMRIVN
QRQFDRLTGYLANTKGTVAVGGTSAAADLRIQPTVVVDPDPQEPLMTNEVFGPILPVVTT
ESLDEAIRFVNSRPKPLAAYLFTKTRAVRERVIKEVPAGGMVVNHLAFHYFTSKLPFGGV
GPSGMGAYHGRWGFEEFSHRKSVLTKPTRPDLSSFIYPPYTEKAWKLARRLF
NT seq 1419 nt   +upstreamnt  +downstreamnt
atgactagcgaagccgccgcacaacccagccccgacaccgccgcatccgctcgaacggac
atcccgcaaacggtcgctcacctacgggaaaccttcgccaccggccgaagccgcagcctt
gagtggcggcgcacgcagttgcgcgccatcgagaagatgatggccgagaacgagaccaag
atcgccgaggcgcttcaagccgacctgtgccgcaaaccattcgaggcgtggatggccgac
atcgcgggcaccgccgccgaagcgcggtatgcggccaagcacgttggcagttggatgcgc
cgtaaataccgcctgctggaacgcgcacagctgcccggcctcggctgggtggagtacgaa
ccctacgggacggtgctgataatcggtgcatggaactacccatttgtattgacccttggc
ccagccatcggggcgatcgctgccggaaacactatggtgctcaagccttctgaggtcacc
ccagcgtcttcgcggttgatagccgaactggtgccgcgatacctggacggcgaagcgatc
gcggtagtcgagggcgacgctgcggtcagccagcagttgatcgcccaaggcttcgatcgg
gtggtgttcaccggcggcacggagatcggccgcaaagtctatgaagctgctgcaccacac
ttgactcccgtcactctcgaactgggcggtaagagcccggtgatcgtcgctgcggacgct
gacgtggacgtcgccgccaagcgcatcgcctggatcaaactgctcaactccggccagacc
tgcattgcgccggactatgtgctggcggacgcgaggatccgcgacgaactcgtcaccaag
atcggcgaagccatcaccacgttcggctccgacgagccagccggaatgcgcatcgtcaac
caacgccaattcgaccggctgaccggttacctggccaacacgaagggtaccgtcgccgtg
ggaggcacttcagctgctgcggatctgcggattcagccgacggtggtggtcgacccggat
ccgcaggaaccgctgatgaccaacgaggtctttggcccgattctgcccgtggtcacgacc
gagtctttggatgaggcaatacgtttcgtcaactcgaggcccaagccgctggcggcgtat
ctgttcaccaagacccgcgccgtgcgtgagcgggtgatcaaggaagtgccagcgggcggc
atggtggtcaaccacctcgccttccactacttcacgtccaagctgccgttcggtggcgtc
ggcccgtccggcatgggcgcctaccacggccgttgggggttcgaggaatttagccaccgc
aagtcggtgctcaccaagccaacccgccccgacttatcgagctttatctacccgccgtat
acagagaaggcgtggaagttggcgcgccggctcttctag

KEGG   Mycobacterium noviomagense: MNVI_19690
Entry
MNVI_19690        CDS       T06809                                 

Definition
(GenBank) aldehyde dehydrogenase
  KO
K00128  aldehyde dehydrogenase (NAD+) [EC:1.2.1.3]
Organism
mnv  Mycobacterium noviomagense
Pathway
mnv00010  Glycolysis / Gluconeogenesis
mnv00053  Ascorbate and aldarate metabolism
mnv00071  Fatty acid degradation
mnv00280  Valine, leucine and isoleucine degradation
mnv00310  Lysine degradation
mnv00330  Arginine and proline metabolism
mnv00340  Histidine metabolism
mnv00380  Tryptophan metabolism
mnv00410  beta-Alanine metabolism
mnv00561  Glycerolipid metabolism
mnv00620  Pyruvate metabolism
mnv00625  Chloroalkane and chloroalkene degradation
mnv00770  Pantothenate and CoA biosynthesis
mnv00903  Limonene and pinene degradation
mnv01100  Metabolic pathways
mnv01110  Biosynthesis of secondary metabolites
mnv01120  Microbial metabolism in diverse environments
mnv01240  Biosynthesis of cofactors
Brite
KEGG Orthology (KO) [BR:mnv00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    MNVI_19690
   00053 Ascorbate and aldarate metabolism
    MNVI_19690
   00620 Pyruvate metabolism
    MNVI_19690
  09103 Lipid metabolism
   00071 Fatty acid degradation
    MNVI_19690
   00561 Glycerolipid metabolism
    MNVI_19690
  09105 Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    MNVI_19690
   00310 Lysine degradation
    MNVI_19690
   00330 Arginine and proline metabolism
    MNVI_19690
   00340 Histidine metabolism
    MNVI_19690
   00380 Tryptophan metabolism
    MNVI_19690
  09106 Metabolism of other amino acids
   00410 beta-Alanine metabolism
    MNVI_19690
  09108 Metabolism of cofactors and vitamins
   00770 Pantothenate and CoA biosynthesis
    MNVI_19690
  09109 Metabolism of terpenoids and polyketides
   00903 Limonene and pinene degradation
    MNVI_19690
  09111 Xenobiotics biodegradation and metabolism
   00625 Chloroalkane and chloroalkene degradation
    MNVI_19690
Enzymes [BR:mnv01000]
 1. Oxidoreductases
  1.2  Acting on the aldehyde or oxo group of donors
   1.2.1  With NAD+ or NADP+ as acceptor
    1.2.1.3  aldehyde dehydrogenase (NAD+)
     MNVI_19690
SSDB
Motif
Pfam: Aldedh
Other DBs
NCBI-ProteinID: BBY06651
UniProt: A0A7I7PDK5
Position
complement(2119128..2120600)
AA seq 490 aa
MPDSQKTEYDKLFIGGKWTEPSTSDVIEVHCPATGEYVGKVPLAAAADVDAAVAAARKAF
DTGPWPSTPPAERAAVIANALKVMEERKELFTRLLADETGQPPTTIETMHWMSSIGALNF
FAGPAVEQVKWKEIRNGGYGQSIVYREPLGVVGAIVAWNVPLFLAVNKLGPALLAGCTVV
LKPAAETPLSANALAEVFVEAGLPEGVLSIVPGGIETGQALTSNPDIDIFTFTGSSAVGK
EIGRRAADLLKPCTLELGGKSAAIVLADVDLASAIPMLVFSGIMNTGQACVAQTRILAPR
SRYDEIVDAVSDFVQALPVGLPSDPVAQIGSLISEKQRSRVEGYIAKGIEEGARLVCGGG
RPEGLDSGYFVQPTVFADVDNNMTIAQEEIFGPVLSIIPYDSEEDAIAIANDSVYGLAGS
VWTTNIPRGIEIAEKIRTGTYAINWYAFDPCCPFGGYKNSGIGRENGPEGVEHFTQQKSV
LMPMGYTIDS
NT seq 1473 nt   +upstreamnt  +downstreamnt
atgcccgacagccagaagaccgagtacgacaagcttttcatcggcggcaagtggacggag
ccgtcgacgtcagacgtgatcgaggtgcactgcccggccaccggcgagtatgtcggcaag
gtgccgcttgcggcggccgccgacgtcgacgccgccgtcgcggcggcccgcaaggcgttc
gacaccgggccctggccgtccaccccgccggccgagcgcgcggccgtcatcgccaatgcg
ctcaaggtgatggaagagcgcaaggagctgttcaccagattgctcgccgacgaaaccggc
cagccgccgacgaccatcgagacgatgcactggatgagctcgatcggagcgctgaatttc
ttcgccggccccgccgtcgaacaggtcaagtggaaagagatccgcaacggcggatacggg
caaagcatcgtctatcgcgagccgctcggtgtcgtcggcgcgatcgtcgcgtggaacgtg
ccgctgttcctagccgtcaacaagctgggtccggcgctgctggccggctgcacggtggtg
ctgaagcccgccgccgaaacaccgctgagcgcaaatgctttggcggaggtgttcgtcgaa
gccggcctacccgagggtgtgctctcgatagttcccggtgggatcgagaccgggcaagca
ttgacgtccaacccggacatcgacatcttcaccttcaccggcagctcggccgtcgggaag
gagatcggtcggcgcgccgcggacctgctcaagccgtgcaccctggaactcggcgggaaa
tcggcggccatcgtcctcgccgacgtcgatctggcctctgccatcccgatgttggtgttc
tccgggatcatgaacaccgggcaggcctgtgtggctcagacccgtatcctggcgccgcgg
tcgcggtacgacgagatcgtcgatgcggtcagcgatttcgtgcaggcactgccggtcggg
ctgccgtcggacccagtcgcccagatcggttcgctgatctcggagaagcagcgtagccgg
gtcgagggttacatcgccaaaggcatcgaggaaggcgcgcggctggtctgtggcggcggc
cgtcccgaaggcctcgacagcggctacttcgtgcagccgacggtgttcgccgacgtcgac
aacaacatgacgatcgcgcaggaagaaatcttcggaccggtgctgtccatcatcccgtac
gacagcgaggaggacgcgatcgcgatcgccaacgattcggtgtacgggctggccggcagc
gtgtggaccactaacattccgcgcggcatcgagattgcggagaagatccgcaccggaacg
tatgccatcaactggtacgcgttcgatccctgctgcccgttcggcggctacaaaaactcc
ggcatcggccgcgagaatgggcctgagggcgtcgagcacttcacgcagcagaagagcgtg
ctgatgcccatgggctacaccatcgacagctga

KEGG   Mycobacterium noviomagense: MNVI_27750
Entry
MNVI_27750        CDS       T06809                                 

Gene name
pcd
Definition
(GenBank) aldehyde dehydrogenase
  KO
K00128  aldehyde dehydrogenase (NAD+) [EC:1.2.1.3]
Organism
mnv  Mycobacterium noviomagense
Pathway
mnv00010  Glycolysis / Gluconeogenesis
mnv00053  Ascorbate and aldarate metabolism
mnv00071  Fatty acid degradation
mnv00280  Valine, leucine and isoleucine degradation
mnv00310  Lysine degradation
mnv00330  Arginine and proline metabolism
mnv00340  Histidine metabolism
mnv00380  Tryptophan metabolism
mnv00410  beta-Alanine metabolism
mnv00561  Glycerolipid metabolism
mnv00620  Pyruvate metabolism
mnv00625  Chloroalkane and chloroalkene degradation
mnv00770  Pantothenate and CoA biosynthesis
mnv00903  Limonene and pinene degradation
mnv01100  Metabolic pathways
mnv01110  Biosynthesis of secondary metabolites
mnv01120  Microbial metabolism in diverse environments
mnv01240  Biosynthesis of cofactors
Brite
KEGG Orthology (KO) [BR:mnv00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    MNVI_27750 (pcd)
   00053 Ascorbate and aldarate metabolism
    MNVI_27750 (pcd)
   00620 Pyruvate metabolism
    MNVI_27750 (pcd)
  09103 Lipid metabolism
   00071 Fatty acid degradation
    MNVI_27750 (pcd)
   00561 Glycerolipid metabolism
    MNVI_27750 (pcd)
  09105 Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    MNVI_27750 (pcd)
   00310 Lysine degradation
    MNVI_27750 (pcd)
   00330 Arginine and proline metabolism
    MNVI_27750 (pcd)
   00340 Histidine metabolism
    MNVI_27750 (pcd)
   00380 Tryptophan metabolism
    MNVI_27750 (pcd)
  09106 Metabolism of other amino acids
   00410 beta-Alanine metabolism
    MNVI_27750 (pcd)
  09108 Metabolism of cofactors and vitamins
   00770 Pantothenate and CoA biosynthesis
    MNVI_27750 (pcd)
  09109 Metabolism of terpenoids and polyketides
   00903 Limonene and pinene degradation
    MNVI_27750 (pcd)
  09111 Xenobiotics biodegradation and metabolism
   00625 Chloroalkane and chloroalkene degradation
    MNVI_27750 (pcd)
Enzymes [BR:mnv01000]
 1. Oxidoreductases
  1.2  Acting on the aldehyde or oxo group of donors
   1.2.1  With NAD+ or NADP+ as acceptor
    1.2.1.3  aldehyde dehydrogenase (NAD+)
     MNVI_27750 (pcd)
SSDB
Motif
Pfam: Aldedh
Other DBs
NCBI-ProteinID: BBY07457
UniProt: A0A7I7PFQ8
Position
complement(2945412..2946926)
AA seq 504 aa
MRLPTAEDLRARVRQALEAIGADVILGAPGQPGLPARTPITGDALFTIAPSTPAEVDQTI
AAGAQAFSTWRATPAPVRGALVGRLGELLTTHKADLATLVTVEAGKITSEAAGEVQEMID
ICQFAVGLSRQLYGRTIASERPGHRLLETWHPLGVVGVITAFNFPVAVWAWNTAVALVCG
DTVVWKPSELTPVTALACQALVARAAEDVGARSAVSGLLLGGPDVGQQLVDDERIALVSA
TGSVRMGQQVGPRVARRFGRTLLELGGNNAAIVTPSADLELAVRAIVFAAAGTAGQRCTT
LRRLIVHRSIADEVVERVLAAYRQLRIGDPSAQGTLVGPLIHEKAYADMVKALEQARGDG
GEVVGGERHGPQGAYYVSPALVRMPAQTAIVATETFAPILYVLIYDDFDDAIALNNGVPQ
GLSSAIFTADVQEAERFIDESDCGIANVNIGTSGAEIGGAFGGEKQTGGGRESGSDAWKA
YMRRATNTVNYSSQLPLAQGVRFT
NT seq 1515 nt   +upstreamnt  +downstreamnt
atgagactgcccaccgcagaagatttacgcgcccgggtacgccaggcgctggaggcgatc
ggcgccgacgtgatcctgggtgcgccgggccagcccggcctgccggcacgcaccccaatc
accggcgatgcgctgttcaccatcgcgcccagcacgcccgcagaggtcgatcagaccatc
gcagctggcgcacaagcgttttcgacgtggcgagccacccctgcgccggtacgcggcgcg
ctggtgggccgccttggcgaactgctgaccacacacaaggccgatctcgccaccttggtc
accgtggaggccggcaagatcacctccgaggcggcaggtgaggtgcaggagatgatcgac
atctgccagttcgccgtcggcctgtcgcgccagctgtacgggcgcaccatcgcttccgag
cgtccgggacatcggctgctggagacctggcacccgctgggtgtggttggggtaattacc
gcattcaacttcccggtggcggtctgggcgtggaacaccgcggtggcgttggtgtgcggc
gacaccgtggtgtggaagccctcggagctgacgccggtgaccgcgctggcctgccaggcg
ctggtcgcccgggcggccgaagatgtgggcgcacggtccgcggtcagcggcctgctgctg
ggcggtcccgacgtcggccagcagctggtggacgacgaacgcatcgcgctggtgtcggcg
accggctcagtgcggatgggccagcaggtcggcccccgggtggcacgacgcttcgggcga
acgctgctcgagctcggcgggaacaacgccgcgatcgtgacaccgtcggccgaccttgag
ctggcggtgcgcgccatcgtgttcgccgcggccggcactgccgggcagcgctgcacgacg
ttgcgccggctgatcgtgcaccggtcgatcgccgacgaggtggtggaacgcgtcctggcc
gcctaccggcagctgcgcatcggtgatccgtcggcgcagggcacgctggtcgggccgctg
atccacgagaaggcctacgccgacatggtcaaagcgctggagcaggcccgcggcgacggc
ggcgaggtcgtcggcggtgagcgccacgggccacagggtgcgtattacgtctcgccggca
ctggtgcggatgccggcgcaaaccgcgattgtggcaaccgagacgttcgcgccgatcctc
tacgtgctgatctacgacgatttcgacgacgcaatagcgctgaataacggcgtcccacaa
gggctttcctcggcgatcttcaccgccgacgtgcaggaggccgagcgtttcatcgacgaa
tccgactgtggcatcgccaacgtcaacatcggcacttcgggggcggagatcggcggagcg
ttcggcggcgaaaagcagaccggcggcgggcgcgaatccggttccgatgcatggaaggcg
tatatgcgtcgcgccaccaacaccgtcaactactcgtcgcagttaccgcttgcccagggc
gtgcggttcacatga

KEGG   Mycobacterium noviomagense: MNVI_29360
Entry
MNVI_29360        CDS       T06809                                 

Definition
(GenBank) aldehyde dehydrogenase
  KO
K00128  aldehyde dehydrogenase (NAD+) [EC:1.2.1.3]
Organism
mnv  Mycobacterium noviomagense
Pathway
mnv00010  Glycolysis / Gluconeogenesis
mnv00053  Ascorbate and aldarate metabolism
mnv00071  Fatty acid degradation
mnv00280  Valine, leucine and isoleucine degradation
mnv00310  Lysine degradation
mnv00330  Arginine and proline metabolism
mnv00340  Histidine metabolism
mnv00380  Tryptophan metabolism
mnv00410  beta-Alanine metabolism
mnv00561  Glycerolipid metabolism
mnv00620  Pyruvate metabolism
mnv00625  Chloroalkane and chloroalkene degradation
mnv00770  Pantothenate and CoA biosynthesis
mnv00903  Limonene and pinene degradation
mnv01100  Metabolic pathways
mnv01110  Biosynthesis of secondary metabolites
mnv01120  Microbial metabolism in diverse environments
mnv01240  Biosynthesis of cofactors
Brite
KEGG Orthology (KO) [BR:mnv00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    MNVI_29360
   00053 Ascorbate and aldarate metabolism
    MNVI_29360
   00620 Pyruvate metabolism
    MNVI_29360
  09103 Lipid metabolism
   00071 Fatty acid degradation
    MNVI_29360
   00561 Glycerolipid metabolism
    MNVI_29360
  09105 Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    MNVI_29360
   00310 Lysine degradation
    MNVI_29360
   00330 Arginine and proline metabolism
    MNVI_29360
   00340 Histidine metabolism
    MNVI_29360
   00380 Tryptophan metabolism
    MNVI_29360
  09106 Metabolism of other amino acids
   00410 beta-Alanine metabolism
    MNVI_29360
  09108 Metabolism of cofactors and vitamins
   00770 Pantothenate and CoA biosynthesis
    MNVI_29360
  09109 Metabolism of terpenoids and polyketides
   00903 Limonene and pinene degradation
    MNVI_29360
  09111 Xenobiotics biodegradation and metabolism
   00625 Chloroalkane and chloroalkene degradation
    MNVI_29360
Enzymes [BR:mnv01000]
 1. Oxidoreductases
  1.2  Acting on the aldehyde or oxo group of donors
   1.2.1  With NAD+ or NADP+ as acceptor
    1.2.1.3  aldehyde dehydrogenase (NAD+)
     MNVI_29360
SSDB
Motif
Pfam: Aldedh
Other DBs
NCBI-ProteinID: BBY07618
UniProt: A0A7I7PG70
Position
3101295..3102779
AA seq 494 aa
MADTTKVRFESRMLIDGKLVDGEAGTFTNINPATEEVLGEVADASKADMHRAIDAARRAF
DETDWSTSPGFRKACLEQFQEALEAEKEALREELILEVGCPRAITYGPQLDAPLADALRY
PIKLIDEYPWETDLGDALVAVTGQMTTRKVWREPVGVVGAITPWNFPFEVTIHKLAQALA
TGNTVVLKPAPDTPFNATRLGRLIAESTDIPAGVVNVVTASDHLVGEELTLSPKVDLISF
TGSTVVGQRIMEKGAATMKRLFLELGGKSATIVLEDADFAMACAIGIAPCMHAGQGCANP
TRLLLPRSRYDEGVANLKAMYENVSPGDPQDPGTLCGPVISDKQRKRVLGYIQKGIDEGA
TCLVGGTEPPAGFDKGFWVQPTLFVDVDNKMTIAQEEIFGPVLSVIPFDDEEDAIRIAND
SMYGLAGNVMSGSVEHSLAVARRIRAGFIGAQGAAPYGADTPFGGYKYSGIGRQNGVAGF
DQYTEIKSVGYPAG
NT seq 1485 nt   +upstreamnt  +downstreamnt
atggctgacacaacgaaagtccgcttcgagtcgcgaatgcttatcgacggcaagctcgtc
gacggcgaggccggcacgttcaccaacatcaacccggccaccgaggaggtgctcggcgaa
gtcgccgacgcgtcgaaggcggacatgcaccgcgcaatcgacgcggcgcggcgggcgttt
gacgaaaccgactggtcgaccagccccggttttcgcaaggcctgcctcgagcagttccag
gaagcgctcgaggccgaaaaggaagcgttgcgcgaagagctcatcctcgaggtcggctgc
ccgcgcgcgatcacctacgggccacagctcgacgccccactggccgatgcgctgcggtac
ccgatcaagctgatcgacgaatacccttgggagaccgatcttggcgacgcgctcgtggct
gtgaccggtcagatgaccacccgtaaggtgtggcgcgaaccagtgggggtggtaggcgcg
atcacgccgtggaacttcccgttcgaagtcaccatccacaagctcgcccaagcgctggcc
accggcaacaccgtcgtgctgaaaccggcccccgacaccccgttcaacgcgacccggctc
gggcgcctgatcgccgaatccaccgacatccccgccggtgtggtcaacgtcgtcaccgcg
tcggatcacctggtaggggaggaactcacgctgtcacccaaggtcgacctgatctcgttc
accggttccaccgtggtcgggcagcgcatcatggagaaaggcgcagcgacgatgaagcgc
ctgttcctcgaactcggcggcaagtcggccaccattgtgttggaggacgccgatttcgcg
atggcatgtgcgatcggcatcgcgccgtgcatgcacgccggacagggctgcgcgaacccg
acccggttgttgctgccacggtctcggtatgacgaaggcgtagccaacctcaaggcgatg
tacgagaacgtctccccgggagacccgcaggatcctggaaccctctgcggtccagtaatt
tcggacaagcagcgcaagcgcgtgctcggctacatccagaaaggcatcgacgagggcgcc
acctgcctcgtcggcggcaccgagccaccggccggattcgacaagggattctgggtgcag
ccaacgcttttcgtcgacgtcgataacaagatgaccatcgcacaggaagagatattcggg
ccggtgctctccgtcattccattcgacgacgaagaggacgcgatccgcatcgccaacgac
agcatgtacggccttgccggcaacgtgatgtcgggttcggtcgagcactcgttggcggtg
gctcgccggatacgggccgggttcatcggcgcgcaaggcgccgcaccctacggcgccgat
acaccgttcggcggctacaagtacagcggcatcggccgccagaacggcgtggccgggttc
gaccaatacacggagatcaaatcggtgggctaccccgccggctga

DBGET integrated database retrieval system