KEGG   Mycobacterium noviomagense: MNVI_09910
Entry
MNVI_09910        CDS       T06809                                 

Definition
(GenBank) putative short-chain type dehydrogenase/reductase
  KO
K12466  (+)-trans-carveol dehydrogenase [EC:1.1.1.275]
Organism
mnv  Mycobacterium noviomagense
Pathway
mnv00903  Limonene and pinene degradation
mnv01110  Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:mnv00001]
 09100 Metabolism
  09109 Metabolism of terpenoids and polyketides
   00903 Limonene and pinene degradation
    MNVI_09910
Enzymes [BR:mnv01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.275  (+)-trans-carveol dehydrogenase
     MNVI_09910
SSDB
Motif
Pfam: adh_short_C2 adh_short KR
Other DBs
NCBI-ProteinID: BBY05673
UniProt: A0A7I7PAP9
Position
1063198..1064034
AA seq 278 aa
MTGRVEGKVAFITGAARGQGRAHAVRLAQEGADIIAVDICKPIESVQIPLATPEDLAETA
DLVKGQNRRVYTAEVDVRDYKALKAAVDAGVEQLGRLDIIVANAGIGNGGATLDKTSERD
WTDMIDVNLSGVWKTVKAGVPHILSGGRGGSIILTSSVGGLKAYPHTGHYVAAKHGVVGL
MRTFAVELGQHMIRVNSVHPTNVNTPLFMNEGTMKLFRPDLENPGPDDMKVVAQMMHTLP
IGWVEPEDISNAVLFLASDEARYITGVTLPVDAGSCLK
NT seq 837 nt   +upstreamnt  +downstreamnt
atgactgggcgagtcgaaggcaaggtcgcattcatcaccggcgcagcgcgggggcaaggt
cgcgcgcatgcggtgcgattggcgcaggagggtgccgacatcattgccgtcgacatctgc
aagccgatcgaaagcgtccagattccgcttgcgaccccggaggatctggccgagaccgcc
gatctggtgaaaggccagaaccgccgcgtctataccgccgaagtcgacgtccgtgactac
aaagcactgaaagctgcggtagacgctggtgtggagcagctgggcaggctggacatcatc
gtggccaacgcgggcatcggcaatggtggggcaacgctcgacaaaaccagcgaacgagac
tggaccgacatgatcgacgtcaacctctccggcgtctggaagacggtgaaagccggtgtg
ccacatatcctctcgggcggccgcggcggatcgatcatcttgaccagttcagtcggcggg
ctgaaggcctatccgcacaccggtcactatgtggcggccaagcacggcgtcgtcgggctg
atgcgcacgttcgcagtcgaactgggccagcacatgattcgcgtcaattcagtgcacccg
accaatgtgaacactccgttgttcatgaatgagggcacgatgaaactgttccggccggac
ttggagaaccccgggcccgacgacatgaaggtcgtcgcgcagatgatgcacacgctgccg
atcggctgggtggaacccgaagacatcagcaacgcggtgctgttcttggcttcggacgag
gcccgctacatcaccggtgtgacacttccggtcgacgcgggcagctgcctgaagtag

KEGG   Mycobacterium noviomagense: MNVI_29750
Entry
MNVI_29750        CDS       T06809                                 

Definition
(GenBank) oxidoreductase
  KO
K12466  (+)-trans-carveol dehydrogenase [EC:1.1.1.275]
Organism
mnv  Mycobacterium noviomagense
Pathway
mnv00903  Limonene and pinene degradation
mnv01110  Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:mnv00001]
 09100 Metabolism
  09109 Metabolism of terpenoids and polyketides
   00903 Limonene and pinene degradation
    MNVI_29750
Enzymes [BR:mnv01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.275  (+)-trans-carveol dehydrogenase
     MNVI_29750
SSDB
Motif
Pfam: adh_short_C2 adh_short KR Pterin_bind
Other DBs
NCBI-ProteinID: BBY07657
UniProt: A0A7I7PGB6
Position
complement(3138267..3139103)
AA seq 278 aa
MAGRVEGKVAFVTGAARGQGRSHAVRLAQEGADIIAVDICQAFDRSPAPGSTPEDLAETA
EMVKNLDRRIVTAQVDARDFDALKHAVDGGVEQFGKFDIIVANAGIGTMGDKLHKVDEAL
WQEMIDVNLGSVWKTVKAGVPHLLAGGRGGSVILTSSVAGLKAYPYMGHYNVAKHGVVGL
MRTFAVELGPHFIRVNSVHPTHTATPLLLNEGTYRGFRPDLDNPGPDDLAPVCQTFHILP
IPWVQAEDISNAVLFLASDESRYITGVTLPVDAGSCLK
NT seq 837 nt   +upstreamnt  +downstreamnt
atggcgggccgcgttgaaggcaaagtcgcgttcgtcaccggcgcggcgcgcggtcaggga
cgcagtcacgcagtccggttggcgcaggagggcgccgacatcattgcggtcgacatctgc
caggcgttcgaccgctctccggcacccggctcgacgcccgaagacctcgccgaaaccgcc
gagatggtcaagaacctggaccggcgcatcgtcaccgcacaagtcgatgcccgcgacttc
gacgccctgaagcacgctgtcgacggtggtgtcgaacaattcggcaagttcgacatcatc
gtcgccaacgccggcatcggcaccatgggcgacaaactgcacaaggtcgacgaagcgttg
tggcaggagatgattgacgtcaacctcggcagtgtgtggaagaccgtgaaggccggtgtt
ccgcatctgctggccggtggccggggtggttcggtgatcctgaccagctcggtcgccggc
ctgaaggcctacccctacatgggccactacaacgtcgccaaacacggtgtcgtcggcctg
atgcgcacgttcgcagtcgagttgggcccgcacttcatccgggtcaactcggtgcatccc
acgcatacggccaccccgctgctgctgaatgagggcacctaccgcggctttcgacccgac
ctggataaccccggcccagacgacctcgcacccgtctgccagacctttcacatcctgccg
atcccgtgggtacaggccgaggacatcagcaacgccgtgctgtttctggcctctgacgaa
tcgcgctacatcaccggcgtcacgctgcctgtcgacgccggaagctgcctgaaataa

DBGET integrated database retrieval system