KEGG   Mycobacterium noviomagense: MNVI_12960
Entry
MNVI_12960        CDS       T06809                                 

Definition
(GenBank) monooxygenase
  KO
K14733  limonene 1,2-monooxygenase [EC:1.14.13.107]
Organism
mnv  Mycobacterium noviomagense
Pathway
mnv00903  Limonene and pinene degradation
Brite
KEGG Orthology (KO) [BR:mnv00001]
 09100 Metabolism
  09109 Metabolism of terpenoids and polyketides
   00903 Limonene and pinene degradation
    MNVI_12960
Enzymes [BR:mnv01000]
 1. Oxidoreductases
  1.14  Acting on paired donors, with incorporation or reduction of molecular oxygen
   1.14.13  With NADH or NADPH as one donor, and incorporation of one atom of oxygen into the other donor
    1.14.13.107  limonene 1,2-monooxygenase
     MNVI_12960
SSDB
Motif
Pfam: Bac_luciferase
Other DBs
NCBI-ProteinID: BBY05978
UniProt: A0A7I7PBL9
Position
1361658..1362851
AA seq 397 aa
MSGPLRFGAFITPFHPTGQSPTVAIEYDMERVVALDRLGFDEAWFGEHHSGGYELIACPE
VFIAAAAERTKHIRLGTGVVSLPYHHPLMVADRWVLLDHLTRGRVMFGTGPGALPSDAYM
MGIDPVEQRRMMHESLEAILALFRAAPGERISRHSDWFTLRDAQLHIRPYTWPYPEIATA
AMISPSGPRLAGALGTSLLSLSMSVPGGYAALENAWEVVCDQAGKTGRDEPDRAGWRVLG
IMHLADSRDQAIDDCTYGLQDFAKYFGAAGFVPLANLVEGAQSPREFVEDYAAKGNCCIG
TPDDAIGYIQDLLDRSGGFGTFLMLGHDWAPPEATYHSYELFARKVIPHFKGQLGAPRAS
HEWARGMRDQLLGRAGEAVVKAISEHTDELKLESEQS
NT seq 1194 nt   +upstreamnt  +downstreamnt
atgagtggtccgctgcgtttcggcgccttcatcacgccgtttcaccccaccggccagtct
cccacggtggcaatcgaatacgacatggagcgcgtcgtcgcactcgaccgcctcgggttc
gacgaagcatggttcggcgagcaccactccggcggctacgagctgatcgcctgcccggag
gtgttcatcgccgcagcggccgagcggaccaaacacattcggctcggcaccggagtggtt
tcgctgccgtaccaccatccgctgatggtcgccgaccgctgggtgctgctggaccatttg
acccgcggcagggtgatgttcggcaccggccccggagcgctgccctcggacgcctacatg
atgggcatcgatccggtcgagcagcgccggatgatgcacgagtcgctggaagcgattctg
gcgctgttccgcgccgcacccggtgagcggatcagccggcactccgattggttcaccttg
cgtgacgcgcagctgcatattcggccctatacctggccgtatcccgagattgccaccgca
gcaatgatttcgccgtccggcccgcggctggccggagcgctgggcacatcgctgctgtcg
ctgtcgatgtcggtgccgggcggatatgcggcgctggaaaacgcgtgggaagtggtgtgc
gaccaagcagggaagaccggacgcgacgaaccggaccgcgcgggttggcgggtgctgggc
atcatgcatctcgccgacagccgcgaccaggcgatcgacgactgcacctacggtctgcag
gatttcgccaaatacttcggcgcagcgggattcgtaccgttggccaatctggtggagggc
gcacagtcgccccgcgagttcgtcgaagactatgcggccaagggcaattgctgcatcggg
acgcccgacgacgcgatcggctacatccaagacctgctcgaccgctccgggggtttcggc
acctttttgatgctcggccacgactgggccccacccgaagcgacctatcactcctacgag
ttgtttgcccgcaaggtgattccccacttcaagggacaactgggcgcgccacgcgcgtcg
cacgagtgggctcgcggtatgcgggatcaactgcttggccgcgccggtgaggcggtggtc
aaagccatcagcgagcacaccgacgaactcaagctggaaagcgagcagagctga

KEGG   Mycobacterium noviomagense: MNVI_42130
Entry
MNVI_42130        CDS       T06809                                 

Definition
(GenBank) putative monooxygenase (luciferase-like)
  KO
K14733  limonene 1,2-monooxygenase [EC:1.14.13.107]
Organism
mnv  Mycobacterium noviomagense
Pathway
mnv00903  Limonene and pinene degradation
Brite
KEGG Orthology (KO) [BR:mnv00001]
 09100 Metabolism
  09109 Metabolism of terpenoids and polyketides
   00903 Limonene and pinene degradation
    MNVI_42130
Enzymes [BR:mnv01000]
 1. Oxidoreductases
  1.14  Acting on paired donors, with incorporation or reduction of molecular oxygen
   1.14.13  With NADH or NADPH as one donor, and incorporation of one atom of oxygen into the other donor
    1.14.13.107  limonene 1,2-monooxygenase
     MNVI_42130
SSDB
Motif
Pfam: Bac_luciferase
Other DBs
NCBI-ProteinID: BBY08895
UniProt: A0A7I7PK02
Position
4404239..4405420
AA seq 393 aa
MSKGTLMGKLRFGYFMAPFHRPGTNPTLALQRDLDFVEHIDALGFDEVWIGEHHSAGSEI
ISSPEIFIAAAAQRTKRIRLGTGVISLAYHNPLWVADRLMLLDHLTHGRVIGGVGPGSLP
TDSAMIGLNPTDTRELLETNLDILVRLLAGESVTAKTATHELFGARLQLGPYSEGGIPLA
VAAVASPTGARLAGKHGIGLLSIGATLSIEGFDALAYHWGIVEERAAAFGKQVDRSDWRL
VGPFHIAETDEQARADVKFGIEPWFHYFQKVAAFPQMTMPGDQLDEMIDIINNAGAGVIG
TTERARAQVQRLWDQSGGFGCMLQMAHEWANPAATKRSAELFAAEVMPHFQGQAQPTLDA
AARASEVREDLAQTQLQAIDHMTKKYQDEVGPK
NT seq 1182 nt   +upstreamnt  +downstreamnt
atgtcaaaggggaccctgatgggcaagctcaggttcggatatttcatggcaccgttccac
cgtccgggcacgaatccgacactggccttgcagcgggatctggacttcgtcgaacacatc
gacgcgctgggcttcgacgaagtgtggatcggtgaacatcactccgcgggcagcgagatc
atcagctcaccggagatctttatcgccgcggctgcgcaacgaaccaagcggatccgcttg
ggcaccggggtcatctcgctcgcctaccacaacccgctgtgggttgccgatcggctgatg
ctgctcgatcacctgacgcacggtcgggtgatcgggggcgtaggaccgggttcgctgccc
accgattcagcgatgatcgggttgaacccgaccgacacccgcgagctgctggaaaccaac
ctcgacattctggtccgcctgttggccggtgagagcgtgaccgccaagaccgccactcac
gagctgttcggcgcgaggctgcagctcggcccgtattccgagggcgggattcccctggcg
gtggcggcggtcgcctcgccgacgggcgccaggctggccggcaagcacggcattggcctg
ctgtccatcggcgcgacactgagcatcgagggtttcgacgccctggcctaccactggggc
atcgtcgaggagcgtgcggcggccttcggcaagcaggtcgaccgcagcgactggcggctg
gtcggacccttccacatcgctgaaaccgacgagcaggcccgcgccgacgtgaaattcggc
atcgagccgtggtttcactactttcagaaggtggccgcattcccgcagatgaccatgcca
ggggatcagctcgacgagatgatcgacatcatcaacaacgctggcgccggtgtgatcggc
acgacggagcgggcgcgcgcacaggtgcagcggctgtgggatcagtcgggcggattcggc
tgcatgctgcagatggcccacgaatgggccaacccggcggcgaccaagcgatcagcggag
ctgttcgccgccgaggtgatgccgcacttccagggccaggcgcaaccgacgctcgacgcc
gctgcgcgagccagcgaagtacgcgaagacctcgcgcagacccaactgcaggccatcgat
cacatgaccaagaagtaccaagacgaagtcgggccgaaataa

DBGET integrated database retrieval system