KEGG   Mycobacterium noviomagense: MNVI_14970
Entry
MNVI_14970        CDS       T06809                                 

Definition
(GenBank) limonene-1,2-epoxide hydrolase
  KO
K10533  limonene-1,2-epoxide hydrolase [EC:3.3.2.8]
Organism
mnv  Mycobacterium noviomagense
Pathway
mnv00903  Limonene and pinene degradation
Brite
KEGG Orthology (KO) [BR:mnv00001]
 09100 Metabolism
  09109 Metabolism of terpenoids and polyketides
   00903 Limonene and pinene degradation
    MNVI_14970
Enzymes [BR:mnv01000]
 3. Hydrolases
  3.3  Acting on ether bonds
   3.3.2  Ether hydrolases
    3.3.2.8  limonene-1,2-epoxide hydrolase
     MNVI_14970
SSDB
Motif
Pfam: LEH SnoaL_2 SnoaL SnoaL_3 DUF4440 SnoaL_4 NTF2 TOBE_3
Other DBs
NCBI-ProteinID: BBY06179
UniProt: A0A7I7PCC9
Position
1557904..1558296
AA seq 130 aa
MTPKQTIQEFIAAFVAAWPERDAARVASFFSDDAVYHNIPMEPVQGLQAIEAAVASFMTM
GGQARVDVGHIVADGAIVMVERVDYFVADQRTIVLPVVGVFEVHNGKIPAWRDYFDSAGL
AAVREDRKDN
NT seq 393 nt   +upstreamnt  +downstreamnt
atgacaccgaagcagacgatccaggagttcattgcggcgttcgtcgcggcgtggccggaa
agggatgccgctcgggttgcgtctttcttcagcgacgacgccgtctatcacaacatcccg
atggagccggttcagggcctgcaggctatcgaagccgccgtggcgagcttcatgaccatg
ggtgggcaggcgcgggtggacgttggtcacatcgtcgccgatggtgcgatcgtgatggtc
gagcgggtcgattacttcgtcgctgaccagcgaacgatcgtcttgccggtcgtcggcgtt
ttcgaggtgcacaacggaaagatcccggcatggcgtgactacttcgattcggctgggctg
gccgctgtgcgtgaggatcgcaaggacaactga

KEGG   Mycobacterium noviomagense: MNVI_33920
Entry
MNVI_33920        CDS       T06809                                 

Definition
(GenBank) limonene-1,2-epoxide hydrolase
  KO
K10533  limonene-1,2-epoxide hydrolase [EC:3.3.2.8]
Organism
mnv  Mycobacterium noviomagense
Pathway
mnv00903  Limonene and pinene degradation
Brite
KEGG Orthology (KO) [BR:mnv00001]
 09100 Metabolism
  09109 Metabolism of terpenoids and polyketides
   00903 Limonene and pinene degradation
    MNVI_33920
Enzymes [BR:mnv01000]
 3. Hydrolases
  3.3  Acting on ether bonds
   3.3.2  Ether hydrolases
    3.3.2.8  limonene-1,2-epoxide hydrolase
     MNVI_33920
SSDB
Motif
Pfam: LEH SnoaL_2 SnoaL
Other DBs
NCBI-ProteinID: BBY08074
UniProt: A0A7I7PHJ5
Position
complement(3555959..3556384)
AA seq 141 aa
MTEPTTVDNTRTVEVFLYALQDEDFDTAGAVLDDDLVYQNVGLPTIYGRDRTMKLFRSMQ
GRARFEVKIHRIASDGAAVLTERTDALIFGPLRLQFWVCGVFEVHNGRITLWRDYFDLYD
MLKATVRGLAATVFPSLRPSF
NT seq 426 nt   +upstreamnt  +downstreamnt
atgactgaaccgaccactgtcgacaacacccgcacggtcgaagtgttcctctacgcgctg
caagacgaagacttcgacaccgcaggcgcagtgttggacgacgacttggtctaccagaac
gtcggactgcccaccatctacggccgtgacaggacgatgaagctgttccgaagcatgcag
ggccgcgcccggttcgaagtcaagatccaccggatcgcatccgacggcgccgcggtgctc
accgaacgcaccgacgcgctgatcttcggcccactgcggctgcagttctgggtgtgcggc
gtcttcgaggtccacaatgggcgaatcacattgtggcgcgactacttcgacctctacgac
atgctcaaggcgacggtgcgcgggctggcagccaccgtgttcccgtcgctgcgtccgtcg
ttctag

DBGET integrated database retrieval system