KEGG   Microvirga ossetica: BB934_02265Help
Entry
BB934_02265       CDS       T05139                                 

Definition
(GenBank) zinc-binding dehydrogenase
  KO
K00004  (R,R)-butanediol dehydrogenase / meso-butanediol dehydrogenase / diacetyl reductase [EC:1.1.1.4 1.1.1.- 1.1.1.303]
Organism
moc  Microvirga ossetica
Pathway
moc00650  Butanoate metabolism
Brite
KEGG Orthology (KO) [BR:moc00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00650 Butanoate metabolism
    BB934_02265
Enzymes [BR:moc01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.4  (R,R)-butanediol dehydrogenase
     BB934_02265
    1.1.1.303  diacetyl reductase [(R)-acetoin forming]
     BB934_02265
    1.1.1.-  
     BB934_02265
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ADH_zinc_N ADH_N Glu_dehyd_C ADH_N_assoc ADH_zinc_N_2 TrkA_N AdoHcyase_NAD
Motif
Other DBs
NCBI-ProteinID: ANY77184
UniProt: A0A1B2EB26
Position
complement(526247..527311)
Genome map
AA seq 354 aa AA seqDB search
MKAVRFYGKHDVRIDDVDEPSTIADDEVLVRSTYCGICGTDLHEYTEGPIWTSATPNSFS
GSALPQILGHEFAGRVEAVGRSVTTLRPGDRVSIQPQLGPRDGYFGSRNLAFLSGRGATI
GLSWPWGGMGEFAVVKDYNAIKLPDDVTDQQGALIEPAAVAVHAIDRSGLKPGGTILITG
AGPIGALAVLAARAAGAGRIFVSEPNPNRRSRIEQLGVGAVLLDPTTESVVDRIRQETDE
GIGVDAAVECAGNGRALDACIDAVRAQGVVVVVGLMQGKTPVEPFKWIIKDITIQGSLCY
PLTIWPRVIDMIRSGLFPVETMIDDEIELTDILEKGFKPLLDPTGAMMKVLVRV
NT seq 1065 nt NT seq  +upstreamnt  +downstreamnt
atgaaggccgtacgtttctatggcaaacacgatgtccgcattgatgacgtcgacgagcca
agcacgatagcagacgacgaagtcctggtacgctcgacctattgcggcatctgcggaacc
gatctccacgaatacacggaaggaccgatctggacctccgcgacgccgaatagtttcagc
ggctcggccttgcctcagatcctcggtcacgagtttgccggacgggtcgaggcggtcggc
cggagcgtaacgaccctccgacctggcgaccgcgtctcgatccagccgcagctcggccct
cgggacggctacttcggcagccgcaacttggccttcctcagtggccgtggcgccaccatc
gggctcagctggccctggggtggaatgggcgagtttgcggttgtcaaagattacaatgca
atcaagctgccggacgacgtgaccgatcaacagggcgcattgattgagcccgcagccgta
gcagttcacgcgatcgaccggagcggcctcaagccgggaggcaccatcctgatcacagga
gccggcccgattggagctctcgcggtcttggcagcccgcgccgctggggccgggcgaatc
ttcgtaagcgagccgaaccctaatcgtcggtcacgcatcgaacagctcggcgtcggcgcg
gtgctcctcgaccctacgacggagtcggttgtagaccgaatccgccaggaaaccgatgaa
ggcatcggggtcgatgcagcggtggaatgcgccggcaacgggcgtgcgctcgatgcgtgc
atcgacgcggttagggcccaaggagtcgttgtcgtcgtcggtttgatgcaaggcaaaacg
ccggtcgagcccttcaagtggattatcaaggatatcacgatccagggttcgctctgctat
ccgctcacgatctggccgcgtgtcatcgacatgatccgaagtggactgttcccggtcgaa
accatgatcgacgacgagatcgaattgactgacatccttgagaagggtttcaagcctctg
ctcgatccaacgggcgcaatgatgaaggttttggttcgcgtttag

DBGET integrated database retrieval system