KEGG   Microvirga ossetica: BB934_20365Help
Entry
BB934_20365       CDS       T05139                                 

Definition
(GenBank) isocitrate dehydrogenase
  KO
K00031  isocitrate dehydrogenase [EC:1.1.1.42]
Organism
moc  Microvirga ossetica
Pathway
moc00020  Citrate cycle (TCA cycle)
moc00480  Glutathione metabolism
moc01100  Metabolic pathways
moc01110  Biosynthesis of secondary metabolites
moc01120  Microbial metabolism in diverse environments
moc01200  Carbon metabolism
moc01210  2-Oxocarboxylic acid metabolism
moc01230  Biosynthesis of amino acids
Module
moc_M00009  Citrate cycle (TCA cycle, Krebs cycle)
moc_M00010  Citrate cycle, first carbon oxidation, oxaloacetate => 2-oxoglutarate
Brite
KEGG Orthology (KO) [BR:moc00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    BB934_20365
  09106 Metabolism of other amino acids
   00480 Glutathione metabolism
    BB934_20365
Enzymes [BR:moc01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.42  isocitrate dehydrogenase (NADP+)
     BB934_20365
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Iso_dh
Motif
Other DBs
NCBI-ProteinID: ANY80293
UniProt: A0A1B2EJX6
Position
complement(4329124..4330338)
Genome map
AA seq 404 aa AA seqDB search
MAKIKVANPVVELDGDEMTRIIWHFIKEKLIHPYLDIDLKYYDLGVEHRDATNDKVTVEA
AEAIKKYGVGVKCATITPDEGRVEEFKLKDMWKSPNGTIRNILGGVIFREPIICKNVPRL
VPGWTQPIIVGRHAFGDQYKATDFKVPGKGRMTIKFEGEDGTVIEKEVFKFPDAGVAMAM
YNLDDSIRDFARASLNYGLNRKYPVYLSTKNTILKVYDGRFKDIFEEIYQNEFKAKFDAA
GIHYEHRLIDDMVASALKWSGGYVWACKNYDGDVQSDTVAQGFGSLGLMTSVLMTPDGQT
VEAEAAHGTVTRHYREHQKGKETSTNSIASIFAWTRGLAHRAKLDDNPELAKFAATLEKV
CVDTVEAGYMTKDLALLVGAEQKWLSTTGFLDKIDENLKKAMAA
NT seq 1215 nt NT seq  +upstreamnt  +downstreamnt
atggcgaagatcaaggttgccaatccggtcgtcgagctcgacggcgacgagatgacccgc
attatctggcacttcatcaaagagaagctgatccacccctatctcgacatcgacctgaag
tactacgacctcggcgtcgagcaccgcgacgcgaccaacgacaaggtcacggtcgaggcg
gcggaagcgatcaagaagtacggcgtcggcgtcaaatgcgccacgatcacgccggacgaa
ggccgcgtcgaggagttcaagctcaaggacatgtggaagtcgcccaacggcacgatccgc
aacatcctcggcggcgtgatcttccgcgagccgatcatctgcaagaacgtgccgcgcctg
gtgccgggctggacccagccgatcatcgtcggccgccatgccttcggcgaccagtacaag
gcgaccgacttcaaggtgcccggcaagggtcgcatgacgatcaagttcgagggcgaggac
ggcacggtcatcgagaaggaggtgttcaagttcccggacgccggcgtcgccatggcgatg
tacaacctcgacgactcgatccgcgactttgcccgcgcctcgctgaactacggcctgaac
cgcaagtatccggtctatctctcgaccaagaacacgatcctgaaggtctatgacggccgc
ttcaaggacatcttcgaggagatctaccagaacgagttcaaggcgaagttcgacgccgcc
ggcatccattacgagcaccgcctgatcgacgacatggtggcctcggcgctgaaatggtcg
ggcggctatgtctgggcgtgcaagaactacgacggcgacgtgcagtccgacacggtggcg
cagggcttcggcagcttgggcctgatgacctcggtgctgatgacgccggacgggcagacg
gtggaggcggaagcagcccacggcacggtgacgcgccattaccgcgagcatcagaaaggc
aaggagacgtcgacgaactcgatcgcctcgatcttcgcctggacccgcggcctggcgcac
cgggccaagctcgacgacaaccccgagctcgccaagttcgccgcgacgctggagaaggtc
tgcgtcgacacggtcgaggccggctacatgaccaaggacctggcgctgctcgtcggcgcc
gagcagaagtggctctccaccaccggcttcctcgacaaaatcgacgaaaacctcaagaag
gcgatggctgcttaa

DBGET integrated database retrieval system