KEGG   Microvirga ossetica: BB934_20940Help
Entry
BB934_20940       CDS       T05139                                 

Definition
(GenBank) 50S ribosomal protein L22
  KO
K02890  large subunit ribosomal protein L22
Organism
moc  Microvirga ossetica
Pathway
moc03010  Ribosome
Brite
KEGG Orthology (KO) [BR:moc00001]
 09120 Genetic Information Processing
  09122 Translation
   03010 Ribosome
    BB934_20940
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03011 Ribosome [BR:moc03011]
    BB934_20940
Ribosome [BR:moc03011]
 Ribosomal proteins
  Mitochondria/ Chloroplast
   Large subunit
    BB934_20940
  Bacteria
    BB934_20940
  Archaea
    BB934_20940
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Ribosomal_L22 DUF3734
Motif
Other DBs
NCBI-ProteinID: ANY80394
UniProt: A0A1B2EK92
Position
4437686..4438066
Genome map
AA seq 126 aa AA seqDB search
MGKAAIPRALSDTEAQAVARMLRVSPQKLNLVAALIRGKKVSSALADLEFSRKRIARDVK
KCLESAIANAENNHNLDVDDLVVSQAYVGKALVMKRFHARARGRGARIMKPFSNLTIVVR
EVAEQA
NT seq 381 nt NT seq  +upstreamnt  +downstreamnt
atgggtaaggccgcgattcctcgcgcactgagcgacacagaggctcaagccgtcgctcgc
atgctgcgcgtcagcccccagaagctcaatcttgttgcggccctcatccgcggcaagaag
gtttcttcggctctcgccgatctcgagttctcccgcaagcgcatcgctcgcgacgtgaag
aagtgcctcgagagcgccatcgccaacgccgagaacaaccacaatctcgatgtggacgat
ctcgtcgtcagccaggcttatgtcggcaaggcgctcgtcatgaagcgcttccacgcccgg
gcccgtggccggggtgctcgtatcatgaagcccttctcgaacctcacgatcgtggttcgg
gaagttgccgaacaggcataa

DBGET integrated database retrieval system