KEGG   Myroides odoratimimus: AS202_01225Help
Entry
AS202_01225       CDS       T04190                                 

Definition
(GenBank) formate--tetrahydrofolate ligase
  KO
K01938  formate--tetrahydrofolate ligase [EC:6.3.4.3]
Organism
mod  Myroides odoratimimus
Pathway
mod00670  One carbon pool by folate
mod01100  Metabolic pathways
mod01120  Microbial metabolism in diverse environments
mod01200  Carbon metabolism
Module
mod_M00140  C1-unit interconversion, prokaryotes
Brite
KEGG Orthology (KO) [BR:mod00001]
 09100 Metabolism
  09108 Metabolism of cofactors and vitamins
   00670 One carbon pool by folate
    AS202_01225
Enzymes [BR:mod01000]
 6. Ligases
  6.3  Forming carbon-nitrogen bonds
   6.3.4  Other carbon-nitrogen ligases
    6.3.4.3  formate---tetrahydrofolate ligase
     AS202_01225
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: FTHFS AAA_31 ParA CbiA AAA_26 Ribosomal_L7Ae ArsA_ATPase
Motif
Other DBs
NCBI-ProteinID: ALU24876
UniProt: A0A0U3H272
Position
284104..285771
Genome map
AA seq 555 aa AA seqDB search
MKTDIEIARECELKRIQDVAHSIGVNEEELIPYGKYMAKVPLDAMNTENINKSNLILVTS
ITPTKAGIGKTTVSIGLALGLNKIGKKAVVALREPSLGPCFGMKGGAAGGGYAQVLPMEN
INLHFTGDFHAITSAHNTISALFDNYIYQNRANENGIKEILWKRVLDVNDRSLRYINTGL
RGSANGVPQESGFDITPASEIMAIMCLATDIEDLRRRIENILLGYRYDGSMFTVKDLGVA
GAITVLLKDALNPNLVQTTENTAAFIHGGPFANIAHGCNSVIATKMAMSYGDYVITEAGF
GADLGAEKFFDIKCRKSGLQPKLTVVVATAQGLKMHGGVAIEDIKAKNTDGIRKGLENLA
KHVENIKSYGQSIVVAFNKYATDDTEELQIVEQYCKDNHIGFAINNAFVEGGEGAKALAE
VVVNTIANNPSKPLHFPYQDSETIAVKIENIAKKIYGANKVEFSSAAKKKLAQLKNTDMD
QYPVCIAKTQYSFSADATAYGVAKDFDIVINDLVINRGSEFIVAIAGDIMRMPGLPKSPQ
ALRIDLVDGLIEGLS
NT seq 1668 nt NT seq  +upstreamnt  +downstreamnt
atgaaaacagatatcgaaattgctcgtgaatgtgagttaaagagaatacaagatgtagca
cactctatcggtgtaaatgaagaagagcttatcccttacggaaagtatatggctaaggtt
cctctagatgctatgaatacagagaacatcaataagtcaaatttaatattagttacttca
atcactcctactaaagcaggtatcggtaagactactgtatctataggtctagcgttgggg
ttaaataaaataggtaagaaagctgtagtagctctacgcgagccttccttaggtccatgc
tttgggatgaaaggtggagctgcaggaggtggatatgctcaggtattgcctatggagaat
atcaacctacacttcacaggagattttcacgctatcacatcagctcataatacgataagt
gctttatttgataactatatctatcagaatagagctaatgaaaacggaattaaagaaata
ttgtggaaaagagtattagatgtgaatgaccgtagcttgcgttatatcaacactgggcta
agaggtagtgctaatggagtaccacaagaatcaggatttgacattactccagcctctgag
attatggctattatgtgtctggcgacagatatagaagaccttagacgcagaatcgaaaat
atcttattagggtatcgatatgacggaagtatgtttacagtaaaagatctaggtgtagct
ggagctattacggtactattaaaagatgcacttaatcctaacttagtacaaactacggaa
aacactgccgcctttattcacggtggaccattcgctaatattgcacatggttgtaactct
gttatcgctactaaaatggctatgagctatggagactatgttatcactgaagcaggcttt
ggtgcagacttaggtgccgaaaaattctttgatatcaagtgtcgtaaatctggtttacaa
ccaaaactgacagtggtagtagctactgcgcaaggattaaaaatgcacggtggtgtagct
atcgaagatatcaaagctaaaaatacagatggtatccgcaaaggattagagaacttagct
aagcatgtagagaatattaaatcttatgggcaaagcatagtagttgccttcaataaatat
gcaactgatgatacagaggaactacaaatagtggagcaatactgtaaggataaccacatt
ggatttgcgattaacaatgcattcgtagaaggtggtgaaggcgctaaagccctagctgaa
gtagttgtaaacacaatagcaaacaacccgagtaaacctcttcacttcccttatcaagac
agtgaaacaatagctgtaaaaatagagaatatcgctaagaagatatatggagctaataaa
gtagagttctcctctgctgctaaaaagaaattagcccaactaaaaaacacagatatggat
caatatccagtatgtattgccaaaacacaatattcattctctgcagatgcaacagcatac
ggtgtagctaaagattttgacattgtaatcaatgatttagtgatcaatagaggttctgag
ttcatcgtggctatagcaggagatattatgcgtatgcctggattgccaaaatcaccacaa
gcgctaagaattgacttagtagatggattaatagaaggattgagctaa

DBGET integrated database retrieval system