KEGG   Myroides odoratimimus: AS202_14440Help
Entry
AS202_14440       CDS       T04190                                 

Definition
(GenBank) threonine aldolase
  KO
K01620  threonine aldolase [EC:4.1.2.48]
Organism
mod  Myroides odoratimimus
Pathway
mod00260  Glycine, serine and threonine metabolism
mod01100  Metabolic pathways
mod01110  Biosynthesis of secondary metabolites
mod01120  Microbial metabolism in diverse environments
mod01130  Biosynthesis of antibiotics
mod01230  Biosynthesis of amino acids
Brite
KEGG Orthology (KO) [BR:mod00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    AS202_14440
Enzymes [BR:mod01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.2  Aldehyde-lyases
    4.1.2.48  low-specificity L-threonine aldolase
     AS202_14440
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Beta_elim_lyase Aminotran_1_2 Aminotran_5 SHMT
Motif
Other DBs
NCBI-ProteinID: ALU27284
UniProt: A0A0U2VP01
Position
complement(3234211..3235230)
Genome map
AA seq 339 aa AA seqDB search
MYSFKNDYAEGMHPNILNRIIETNLIQQAGYGDDDYTLRAKELIQAKTENPQAQIYFVSG
GTQANLLVISSILRTHQAVIAPQTGHIFANETGAIEATGHKVIPVVTTNGKLTAQDIERT
VGEYGLRPHVVEPKMVYISNSTELGTIYTKEELTAISSICKQLGLYLFIDGARLGHALTA
DNNDLTLKDIAGLTDVFYIGATKNGGLLGEAIVFNNTELATYFDYNLKQKGALLAKGRLL
GLQFETLFTDNLYFDLASHANRMATKLTEAFKAKGYHFLGDSTTNQLFPILPLALIEELN
KDYDFYIWKAIDQEYAAIRLITSWATDEEMINQFIEKIK
NT seq 1020 nt NT seq  +upstreamnt  +downstreamnt
atgtacagttttaaaaatgattatgcagaaggcatgcatcctaatatactaaatagaata
atagagactaatctaatccaacaagcaggatatggtgatgatgactatactttaagagca
aaagaattaatccaagctaaaacagagaatcctcaagcacagatctacttcgtatctgga
ggaactcaagcgaacttattagttatttcttctatcctacgtacacatcaagcagtcatt
gcacctcagacagggcatatctttgcgaatgagacaggagctatagaagctacaggacat
aaagtaatcccagtagtgactactaatggtaagctaacggctcaagatatagaacgtaca
gtaggtgaatatggattaagacctcatgtggtagaacctaagatggtgtatatttctaat
tctacagagctgggaactatctatactaaggaagaactaactgccatctcttctatttgt
aaacaattagggttatacctttttatagatggagctagattaggacacgcattgacagct
gataataacgaccttaccttaaaagatatcgctggtctaactgatgtattctatatagga
gcaactaaaaatggcggattattaggtgaggctattgtgtttaataatactgaattagct
acttattttgattataatctaaaacaaaaaggggccttactggcgaagggaagattatta
gggttacaatttgaaactttatttacagataatctatattttgacttagccagccacgct
aatagaatggctaccaaactaacagaagcatttaaagcaaaaggatatcatttcttagga
gattctactacgaatcagttattccctattcttcctttagcactgatagaagagttgaac
aaagattatgatttctatatatggaaagcaatagatcaagaatatgctgctattagacta
atcacttcatgggctacagatgaagagatgatcaatcaatttatagagaagataaagtaa

DBGET integrated database retrieval system