KEGG   Myroides odoratimimus: AS202_15735Help
Entry
AS202_15735       CDS       T04190                                 

Definition
(GenBank) butanediol dehydrogenase
  KO
K00004  (R,R)-butanediol dehydrogenase / meso-butanediol dehydrogenase / diacetyl reductase [EC:1.1.1.4 1.1.1.- 1.1.1.303]
Organism
mod  Myroides odoratimimus
Pathway
mod00650  Butanoate metabolism
Brite
KEGG Orthology (KO) [BR:mod00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00650 Butanoate metabolism
    AS202_15735
Enzymes [BR:mod01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.4  (R,R)-butanediol dehydrogenase
     AS202_15735
    1.1.1.303  diacetyl reductase [(R)-acetoin forming]
     AS202_15735
    1.1.1.-  
     AS202_15735
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ADH_zinc_N ADH_N Glu_dehyd_C AlaDh_PNT_C ADH_zinc_N_2 adh_short HI0933_like 2-Hacid_dh_C 3HCDH_N FAD_binding_3 FokI_C FAD_oxidored
Motif
Other DBs
NCBI-ProteinID: ALU27505
UniProt: A0A0U2XVS7
Position
3505349..3506413
Genome map
AA seq 354 aa AA seqDB search
MSTMKAARWYAAKDIRVEQTEIPTPAKGQVKVAVQYAGICGSDLHEYVHGPQLIPLDKPY
PLNGHQGVTTLGHEFSGIVEELGEGVKNIKVGDRVVIEPIYKNFDSPFVASGEYNLGEHL
GFIGLAGNGGFAKYVVVEDYMIHKIPDTMSFEQGALVEPAAVAVYSVLQSGLKVGQTVLV
SGAGPIGLLCAQAALAAGASTVIVTDVAEKRLEKAKEIGATHVFNAMEADLPAKIKALTG
GLGVNVFLDCAGVQASYNTGIASTRNGGTAVLVALFGKPVQHDALDQVLREITVKGVIAY
RNIFPEVINLIDSGRMEVEKLVTNKIGLDEIVTNGFEALVSNPEQVKILIDINR
NT seq 1065 nt NT seq  +upstreamnt  +downstreamnt
atgagcacaatgaaagcagcacgctggtatgcagccaaagatattagagtagaacaaaca
gaaatccctactccagctaaaggacaggtaaaagtagcagttcaatatgctggtatctgt
ggatcagacttacacgaatatgtacacgggcctcaattaattccattagacaaaccttat
ccattaaatggtcatcagggtgtaactactttaggacatgagttctcaggtatcgttgaa
gaattaggtgaaggtgtaaaaaatattaaagtaggggatcgtgtagtaattgagcctatc
tataaaaacttcgatagtccattcgtagcttctggagaatacaacttaggagaacactta
ggtttcatcggattagcaggtaatggaggatttgcaaaatacgtagtggttgaagattat
atgattcacaaaattcctgatacgatgtcttttgaacaaggtgctttagtagagcctgct
gcagtagctgtatactcagtactacagagtggtctaaaagtaggacagacagtattagta
tctggtgcaggacctatcgggttactatgtgctcaagcagctttagcagctggtgcgtct
actgtgatcgttacagatgtagcagagaaacgcttagagaaagcaaaagaaatcggagct
actcatgtattcaatgctatggaagctgatcttcctgctaagattaaagccttgactggt
ggtctaggagttaatgtattcttagattgtgctggagtacaagcttcttataatacaggt
attgcttctactcgtaatggaggtactgctgtattagttgctttattcggaaaaccagtt
caacacgatgctttagatcaagtattaagagagatcactgtaaaaggggttatcgcttat
agaaatatcttccctgaagtaattaacttaatcgactctggtcgtatggaggtagaaaaa
ttagtgacaaataaaattggtttagacgagattgtaacaaatggttttgaagctttagta
agcaatccagaacaagttaaaatccttattgatatcaatagatag

DBGET integrated database retrieval system