KEGG   Myroides odoratimimus: AS202_17810Help
Entry
AS202_17810       CDS       T04190                                 

Definition
(GenBank) NAD(P)H-dependent oxidoreductase
  KO
K10679  nitroreductase / dihydropteridine reductase [EC:1.-.-.- 1.5.1.34]
Organism
mod  Myroides odoratimimus
Pathway
mod00633  Nitrotoluene degradation
mod01120  Microbial metabolism in diverse environments
Brite
KEGG Orthology (KO) [BR:mod00001]
 09100 Metabolism
  09111 Xenobiotics biodegradation and metabolism
   00633 Nitrotoluene degradation
    AS202_17810
Enzymes [BR:mod01000]
 1. Oxidoreductases
  1.5  Acting on the CH-NH group of donors
   1.5.1  With NAD+ or NADP+ as acceptor
    1.5.1.34  6,7-dihydropteridine reductase
     AS202_17810
  1.-  
   1.-.-  
    1.-.-.-  
     AS202_17810
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Nitroreductase TM1586_NiRdase SAM_3
Motif
Other DBs
NCBI-ProteinID: ALU27889
UniProt: A0A0S7EGQ5
Position
complement(3950664..3951266)
Genome map
AA seq 200 aa AA seqDB search
MSFLEIAKSRYTTKKYDSTKKISGDKIEQLKDILQLSPSSINSQPWKFTIVESTEVKNLL
ASNSAFNQTKIEDASHLIVFNVLSTKEYFEKLRLENAAEGSKMYYNNFLKPKSEEEVTAW
LKNQVYISLGFFLAACGTMGIDATPMEGINTLEFDKIINEDGVYKSVFAVAIGYRNSEDT
NQPSVTPKNRLDKETTIEVR
NT seq 603 nt NT seq  +upstreamnt  +downstreamnt
atgagctttttagaaattgctaagagtagatacacgactaaaaaatatgattctactaaa
aaaataagtggtgacaaaatagaacaattaaaagatatactacaactaagtccttcatcg
attaatagccaaccatggaaatttactattgttgaaagcacagaagtaaaaaatctatta
gcaagtaactcagcttttaatcaaacaaagatagaagatgctagtcacttaattgtgttc
aatgtactaagtacaaaagaatactttgagaaattgcgtttagaaaatgcagctgaaggt
tctaaaatgtattacaataattttctaaaacctaaatcggaagaagaggttacagcttgg
ttaaaaaatcaagtatatatttcattaggattcttcttagcagcttgtggtacaatggga
attgatgcaacaccaatggagggtattaataccctagagtttgataagattatcaatgaa
gatggagtttacaaaagtgtttttgctgtagcaataggatacagaaattctgaagatact
aaccaaccatctgtaactcctaaaaatcgcctagataaagaaactacaatagaagttaga
taa

DBGET integrated database retrieval system