KEGG   Moraxella ovis: MOVS_03815Help
Entry
MOVS_03815        CDS       T04329                                 

Definition
(GenBank) acetyl-CoA hydrolase
  KO
K18118  succinyl-CoA:acetate CoA-transferase [EC:2.8.3.18]
Organism
moi  Moraxella ovis
Pathway
moi00020  Citrate cycle (TCA cycle)
moi00620  Pyruvate metabolism
moi00650  Butanoate metabolism
moi01100  Metabolic pathways
moi01110  Biosynthesis of secondary metabolites
moi01120  Microbial metabolism in diverse environments
moi01130  Biosynthesis of antibiotics
moi01200  Carbon metabolism
Module
moi_M00009  Citrate cycle (TCA cycle, Krebs cycle)
moi_M00011  Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate
Brite
KEGG Orthology (KO) [BR:moi00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    MOVS_03815
   00620 Pyruvate metabolism
    MOVS_03815
   00650 Butanoate metabolism
    MOVS_03815
Enzymes [BR:moi01000]
 2. Transferases
  2.8  Transferring sulfur-containing groups
   2.8.3  CoA-transferases
    2.8.3.18  succinyl-CoA:acetate CoA-transferase
     MOVS_03815
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: AcetylCoA_hyd_C AcetylCoA_hydro CoA_trans
Motif
Other DBs
NCBI-ProteinID: ANB91252
Position
775702..777234
Genome map
AA seq 510 aa AA seqDB search
MIMSIDRIRHAGLREKVMSADQAAEFVKDGMMLAVTGFTGAGYPKALPTAIANKAKAAHA
KGDKFSIGMVTGASTAPECDGVLAEANAVHFRSPFQSDPTLRNGINAGNVAYQDMHLSHV
EQQMRQGFYGEFDIAIIEAAGITEDGKIIFAMGIGHGVEAVKNAKKVIIEINAALSEGLE
GMHDIYGDVGLPPHRKPIPIVGAFDRVGTPALECDADKILGIVLTNAGDRNSKFAEPDDV
SKRIAAQVIDFLDYEVKAGRLPKSLLPLQSGVGNVANAVMAGLLDAPFEDLIGYTEVLQD
GMLDLILAKKMKTASATALSFSPDALARFNENIEFLKDKIILRPMEISNNPELIRRLGVI
GMNSMIEADIYGNVNSTHVMGTRMMNGIGGSGDFTRNGFFSFYVSPSTAKGGAISAIVPM
VSHHDHTEHDVMFIVTEQGMADLRGKSPRQRAKLIIENCSHPDYRDMLRDYYDRAEVASK
KAGGIHTPHLLLEALSWHQRFIETGDMRIK
NT seq 1533 nt NT seq  +upstreamnt  +downstreamnt
atgattatgtcaatcgatcgtattcgtcacgcgggtctgcgtgagaaagtaatgagcgct
gatcaagcggctgaatttgttaaagacggtatgatgcttgccgtcacaggcttcacaggg
gcgggctaccctaaggcgctaccaactgccatcgccaacaaagcaaaagcggcacatgcc
aaaggcgacaagttcagcatcggcatggtgacaggtgcatctaccgcgcctgaatgcgat
ggcgtattggctgaagcgaacgcggtacatttccgctccccattccaatctgatccaacg
cttcgtaatggcattaacgctggtaacgtagcttatcaagacatgcatctatcgcatgtt
gaacagcaaatgcgtcaaggtttctatggcgaatttgacatcgccatcatcgaggcggca
ggcatcaccgaagatggcaaaattatctttgccatgggtatcggtcacggcgtagaagca
gttaagaacgccaagaaagtcatcatcgagatcaacgctgcactaagcgaaggcctagaa
ggcatgcacgacatctatggcgatgttggtctgccacctcatcgcaagccaatccctatc
gtgggtgcttttgaccgtgtcggtacgccagcactggagtgcgatgctgataagattctt
ggtattgtattgaccaatgcaggcgaccgtaactctaagtttgcagagcctgatgatgtg
tctaagcgcatcgctgcccaagtaatcgacttcctggattatgaagtgaaagcaggccgt
ctacctaagagcctactaccacttcaatcaggcgtgggtaacgtagcaaatgcggtaatg
gcaggtctgctagatgcgccatttgaagatttgatcggatatacggaagtgctacaagac
ggtatgcttgatctgatcttggctaagaagatgaaaaccgcttcggcgaccgctttgtca
tttagcccagatgcgctagctcgcttcaacgagaacatcgaattcctaaaagacaaaatc
atcctacgtccaatggaaatcagcaacaacccagagcttatccgccgcttaggtgtgatc
ggcatgaactcaatgatcgaagctgacatctatggtaacgtgaactctacccacgtcatg
ggtactcgtatgatgaatggcatcggtggttcgggtgactttactcgtaacggtttcttt
agtttctatgtcagcccatctactgctaagggcggtgcaatctctgcgatcgtgccaatg
gtgtcgcatcatgaccacactgagcatgacgtgatgttcatcgtgaccgaacaaggcatg
gctgacctacgtggtaagtctccacgtcagcgtgcgaagctaatcatcgagaactgctca
catcctgactatcgcgacatgctgcgtgattactatgatcgagctgaagtggcaagcaaa
aaggcaggcggtatccacacgccacacttattgctagaagcgctatcatggcatcaacgt
ttcatcgaaactggtgacatgcgcatcaaataa

DBGET integrated database retrieval system