KEGG   Moraxella ovis: MOVS_03830Help
Entry
MOVS_03830        CDS       T04329                                 

Definition
(GenBank) acetyl-CoA acetyltransferase
  KO
K00626  acetyl-CoA C-acetyltransferase [EC:2.3.1.9]
Organism
moi  Moraxella ovis
Pathway
moi00071  Fatty acid degradation
moi00072  Synthesis and degradation of ketone bodies
moi00280  Valine, leucine and isoleucine degradation
moi00310  Lysine degradation
moi00362  Benzoate degradation
moi00380  Tryptophan metabolism
moi00620  Pyruvate metabolism
moi00630  Glyoxylate and dicarboxylate metabolism
moi00640  Propanoate metabolism
moi00650  Butanoate metabolism
moi00900  Terpenoid backbone biosynthesis
moi01100  Metabolic pathways
moi01110  Biosynthesis of secondary metabolites
moi01120  Microbial metabolism in diverse environments
moi01130  Biosynthesis of antibiotics
moi01200  Carbon metabolism
moi01212  Fatty acid metabolism
moi02020  Two-component system
Brite
KEGG Orthology (KO) [BR:moi00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00620 Pyruvate metabolism
    MOVS_03830
   00630 Glyoxylate and dicarboxylate metabolism
    MOVS_03830
   00640 Propanoate metabolism
    MOVS_03830
   00650 Butanoate metabolism
    MOVS_03830
  09103 Lipid metabolism
   00071 Fatty acid degradation
    MOVS_03830
   00072 Synthesis and degradation of ketone bodies
    MOVS_03830
  09105 Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    MOVS_03830
   00310 Lysine degradation
    MOVS_03830
   00380 Tryptophan metabolism
    MOVS_03830
  09109 Metabolism of terpenoids and polyketides
   00900 Terpenoid backbone biosynthesis
    MOVS_03830
  09111 Xenobiotics biodegradation and metabolism
   00362 Benzoate degradation
    MOVS_03830
 09130 Environmental Information Processing
  09132 Signal transduction
   02020 Two-component system
    MOVS_03830
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:moi04147]
    MOVS_03830
Enzymes [BR:moi01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.9  acetyl-CoA C-acetyltransferase
     MOVS_03830
Exosome [BR:moi04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   MOVS_03830
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Thiolase_N Thiolase_C ketoacyl-synt
Motif
Other DBs
NCBI-ProteinID: ANB91255
UniProt: A0A160GF63
Position
complement(779835..781121)
Genome map
AA seq 428 aa AA seqDB search
MTTIKKVAILGGNRIPFARSNGAYADASNIDMLSAALEGLVSRFELSDKDIGEVVAGTVL
KHSRDLNLTREALLNTTLAPTTPAYDISQACGTGLQAAFAVANKIALGHIDSGIAGGTDT
TSDAPIALGDGIRKPLLRLNNAKDAKSRLSALSSINPKNLLAFPQNGEPRTHLSMGEHQA
ITALEWDINRADQDALAYASHQNLARAYDEGFFDDLISPYKGLSRDNNLRADTTLDKLAS
LKPVFGKKNANPTMTAANSTPLTDGASCVLLSSEEWAVEHGFEPLAYITHQQTAAVDFVG
KQGLTEGLLMAPAYAVPKMLERAGLTLQDFDFYEIHEAFASQVLSTLAAWEDEKFCQNRL
GLDAPLGSIDRRKLNVNGSSLAAGHPFAATGGRILATAAKLLAQKGSGRALISICAASGQ
GVTCILER
NT seq 1287 nt NT seq  +upstreamnt  +downstreamnt
atgaccactattaagaaagtcgccatcctaggcggcaatcgcattcctttcgctcgttcg
aatggcgcctatgctgacgcaagcaacatcgacatgctaagcgctgctcttgaagggctg
gttagccgatttgaactatctgataaagacatcggtgaagtggtagcaggcacggttcta
aagcacagccgtgatcttaaccttactcgtgaagccctattaaataccactctggcaccg
accacgcctgcctacgacatctcgcaagcttgcggaacgggattgcaggcagcatttgcc
gttgcaaacaaaatcgccttaggtcatatcgacagcggcatcgcaggcggtacagacacc
acttcggacgcaccgatcgcgcttggcgatggcatcagaaagcccctactgcgccttaac
aatgccaaagatgccaaatctcgtctgtctgcactcagcagcatcaacccaaaaaatcta
ctcgccttccctcaaaatggcgaaccgcgcacacacctatccatgggtgaacaccaagcc
atcaccgcactagagtgggacatcaatcgcgccgaccaagacgccttggcttatgccagc
catcagaatttggctcgtgcttatgatgaaggtttttttgatgatctcatcagtccctac
aagggtctaagccgtgataataacttacgagctgataccactcttgataaacttgccagc
ttaaaacctgtatttggcaaaaagaacgccaaccccaccatgaccgccgcaaactccacg
cctctgactgacggtgcctcttgcgtactgctatctagcgaagaatgggcagtagagcat
ggctttgaaccacttgcctatatcacacaccagcagacggcagcggttgattttgtgggc
aagcaaggcctcactgaaggtctactcatggcacctgcctatgccgtgccaaagatgcta
gagcgtgctggcctaacccttcaagattttgatttttatgagattcatgaagctttcgcc
tctcaggtgttatcaaccctagcagcctgggaggacgaaaagttctgccaaaaccgccta
ggtctagatgcgccacttggttcgattgaccgcaggaagcttaacgttaatggctcaagc
ctggcagcaggacatccctttgctgccactggtggacgcatccttgcgaccgccgccaaa
ctacttgcccaaaaaggctcaggccgcgcactaatatccatctgtgccgcaagcggtcaa
ggcgttacttgtatcttagaacgctga

DBGET integrated database retrieval system