KEGG   Moraxella ovis: MOVS_08430Help
Entry
MOVS_08430        CDS       T04329                                 

Definition
(GenBank) 50S ribosomal protein L22
  KO
K02890  large subunit ribosomal protein L22
Organism
moi  Moraxella ovis
Pathway
moi03010  Ribosome
Brite
KEGG Orthology (KO) [BR:moi00001]
 09120 Genetic Information Processing
  09122 Translation
   03010 Ribosome
    MOVS_08430
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03011 Ribosome [BR:moi03011]
    MOVS_08430
Ribosome [BR:moi03011]
 Ribosomal proteins
  Mitochondria/ Chloroplast
   Large subunit
    MOVS_08430
  Bacteria
    MOVS_08430
  Archaea
    MOVS_08430
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Ribosomal_L22
Motif
Other DBs
NCBI-ProteinID: ANB91996
UniProt: A0A160GGE6
Position
complement(1799951..1800280)
Genome map
AA seq 109 aa AA seqDB search
MEVTAKLRGAAISAQKVRLVADEVRGKPIERALDILTFSNKKGAKLVKKCLQSAIANAEH
NNGLDIDTLRVSTIYVDEGITLKRIMPRAKGRADRISKRTCHITVKVGA
NT seq 330 nt NT seq  +upstreamnt  +downstreamnt
atggaagtaactgcaaaattacgtggtgccgccatttcggcacaaaaagtaagattggtt
gcggacgaagttcgtggtaagccaattgagcgcgctttagacatcttgaccttcagcaac
aaaaaaggtgctaaattggtcaaaaaatgcctacaatcagcaattgctaacgctgagcac
aacaacggtctagatattgacacactgcgtgtatctaccatctacgttgatgaaggcatc
actttgaagcgtattatgccccgtgccaaaggtcgtgctgaccgtatcagcaagcgcact
tgtcacatcactgttaaagtaggagcataa

DBGET integrated database retrieval system