KEGG   Moraxella ovis: MOVS_09115Help
Entry
MOVS_09115        CDS       T04329                                 

Definition
(GenBank) hypothetical protein
  KO
K06211  HTH-type transcriptional regulator, transcriptional repressor of NAD biosynthesis genes [EC:2.7.7.1 2.7.1.22]
Organism
moi  Moraxella ovis
Pathway
moi00760  Nicotinate and nicotinamide metabolism
moi01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:moi00001]
 09100 Metabolism
  09108 Metabolism of cofactors and vitamins
   00760 Nicotinate and nicotinamide metabolism
    MOVS_09115
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03000 Transcription factors [BR:moi03000]
    MOVS_09115
Enzymes [BR:moi01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.22  ribosylnicotinamide kinase
     MOVS_09115
   2.7.7  Nucleotidyltransferases
    2.7.7.1  nicotinamide-nucleotide adenylyltransferase
     MOVS_09115
Transcription factors [BR:moi03000]
 Prokaryotic Type
  Helix-turn-helix
   Other families
    MOVS_09115
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: AAA_28 AAA_17 CTP_transf_like dNK AAA AAA_16 MMR_HSR1 ATP-synt_ab AAA_33 TniB
Motif
Other DBs
NCBI-ProteinID: ANB92107
UniProt: A0A378PMC7
Position
1950765..1951775
Genome map
AA seq 336 aa AA seqDB search
MSIGLLMGRFEPLHLGHLQDINIAAGRCDTLHIIVTPSEHQYHTQTLQDKARWVQVACEY
FDFIKVHTSDSLELPVTGDYVQGDLPDESMIQQVLAKVATDSADADVITFIKKDTDGKSA
LVTNEYDKLDIGANPILYFDKLAPSAKSDHVQTVCIVGGESSGKTTLVHKLANHYGATVA
LEMGRLYTHSDLGGTEVGLQYVDYTAIAVNHARAILDAKKHATAPIVLVDTDFVTTQAFC
EEYEGRTHPVVTALADEMCMDHTIYLDNNVKWVADGMRRLGSQKQRSQFATRLLTVLERH
GISPYMIDDDDYHQRYLQAVRYIDDHVLRLTHDSVQ
NT seq 1011 nt NT seq  +upstreamnt  +downstreamnt
atgagtatagggcttttgatgggacggtttgagccgctgcatttgggacatcttcaggac
attaacatcgctgcagggcggtgcgacacattgcacatcattgtcacgcccagcgagcat
cagtatcatacccagaccttgcaggataaggctcgatgggtgcaggtggcgtgtgagtat
tttgattttattaaggtgcatacatcggacagtcttgagctacccgtaacaggtgattat
gtacaaggggatctgcccgatgagtcgatgattcagcaggtgctagccaaggtggctact
gattctgctgatgctgatgtgatcacattcatcaaaaaagacacggatggcaaatcagcg
ctggtcaccaatgaatatgataaattagatattggcgccaatcccattttatactttgat
aaattagcaccgtccgccaagtccgaccatgtgcagacggtgtgtatcgttggcggtgag
agttcgggcaagaccaccttagtgcataagcttgccaatcactacggggcgacagttgcg
ctggagatggggcggctatacacgcacagtgatctgggtggcactgaggtcggtcttcag
tatgtagattatacagccatcgcagtgaatcatgcacgcgccatcctagatgccaaaaaa
cacgccacagcaccgatcgtgctggtggacacggactttgtgaccacgcaggcattctgt
gaagaatacgaggggcgtacccatcctgtggtcacagcattggccgatgagatgtgcatg
gatcacaccatctatctggacaataatgtcaaatgggtggcggatggcatgcgccgccta
ggcagtcaaaagcagcgttctcaattcgccacaagattattaacggtgctcgagcgacac
gggatatcgccttatatgatagacgatgatgattatcaccaaagatatctgcaagcggtt
cgatatattgatgatcatgtgcttagattaacgcatgacagcgtgcaatga

DBGET integrated database retrieval system