KEGG   Methanothermococcus okinawensis: Metok_0943Help
Entry
Metok_0943        CDS       T01534                                 

Definition
(GenBank) pyruvate/ketoisovalerate oxidoreductase, gamma subunit
  KO
K00172  pyruvate ferredoxin oxidoreductase gamma subunit [EC:1.2.7.1]
Organism
mok  Methanothermococcus okinawensis
Pathway
mok00010  Glycolysis / Gluconeogenesis
mok00020  Citrate cycle (TCA cycle)
mok00620  Pyruvate metabolism
mok00633  Nitrotoluene degradation
mok00640  Propanoate metabolism
mok00650  Butanoate metabolism
mok00680  Methane metabolism
mok00720  Carbon fixation pathways in prokaryotes
mok01100  Metabolic pathways
mok01120  Microbial metabolism in diverse environments
mok01130  Biosynthesis of antibiotics
mok01200  Carbon metabolism
Module
mok_M00307  Pyruvate oxidation, pyruvate => acetyl-CoA
mok_M00620  Incomplete reductive citrate cycle, acetyl-CoA => oxoglutarate
Brite
KEGG Orthology (KO) [BR:mok00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Metok_0943
   00020 Citrate cycle (TCA cycle)
    Metok_0943
   00620 Pyruvate metabolism
    Metok_0943
   00640 Propanoate metabolism
    Metok_0943
   00650 Butanoate metabolism
    Metok_0943
  Energy metabolism
   00720 Carbon fixation pathways in prokaryotes
    Metok_0943
   00680 Methane metabolism
    Metok_0943
  Xenobiotics biodegradation and metabolism
   00633 Nitrotoluene degradation
    Metok_0943
Enzymes [BR:mok01000]
 1. Oxidoreductases
  1.2  Acting on the aldehyde or oxo group of donors
   1.2.7  With an iron-sulfur protein as acceptor
    1.2.7.1  pyruvate synthase
     Metok_0943
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: POR CoA_binding
Motif
Other DBs
NCBI-ProteinID: AEH06913
UniProt: F8AMT2
Position
complement(965237..965767)
Genome map
AA seq 176 aa AA seqDB search
MIEIRFHGRGGQGAVTAAQILAKAAFYDGKFSQAFPFFGVERRGAPVMAFTRIDDKKIRL
RSQIYEPDYVIVQDPTLLDIIDIKGGLKKGGKIVVNTHNNLQFSDCEVYTIDATGIALEV
LGLPIVNTAMLGAFTGVTGEVTIESLKKAIMDTFPKKLGEKNAKVAEVAYNMVKGK
NT seq 531 nt NT seq  +upstreamnt  +downstreamnt
atgattgaaattagatttcatggaagaggcggtcaaggagctgttactgctgctcagatt
ttagcaaaagctgctttttatgatggaaagttctcccaagcttttccattttttggtgtt
gaaagaagaggagctccggtaatggcattcacaagaatcgatgataaaaaaataagattg
aggagtcagatatatgagcccgattatgttatagttcaggaccctacccttttagatatt
atcgatattaagggaggtttaaaaaaaggtggaaaaattgtggtaaatacccataataac
ttacaattttctgactgtgaggtatatacaatcgatgcaacaggcatagctcttgaagta
ttggggcttcccattgtaaatactgctatgttaggagcatttacaggagttacaggcgaa
gtcaccattgaatcacttaaaaaggcaattatggatacatttccaaaaaaacttggagaa
aaaaatgcaaaagttgcagaagttgcctataatatggttaaaggaaaataa

DBGET integrated database retrieval system