KEGG   Methanothermococcus okinawensis: Metok_1078Help
Entry
Metok_1078        CDS       T01534                                 

Definition
(GenBank) Tryptophan synthase beta chain
  KO
K01696  tryptophan synthase beta chain [EC:4.2.1.20]
Organism
mok  Methanothermococcus okinawensis
Pathway
mok00260  Glycine, serine and threonine metabolism
mok00400  Phenylalanine, tyrosine and tryptophan biosynthesis
mok01100  Metabolic pathways
mok01110  Biosynthesis of secondary metabolites
mok01130  Biosynthesis of antibiotics
mok01230  Biosynthesis of amino acids
Module
mok_M00023  Tryptophan biosynthesis, chorismate => tryptophan
Brite
KEGG Orthology (KO) [BR:mok00001]
 Metabolism
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    Metok_1078
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    Metok_1078
Enzymes [BR:mok01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.20  tryptophan synthase
     Metok_1078
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PALP
Motif
Other DBs
NCBI-ProteinID: AEH07048
UniProt: F8ANJ4
Position
complement(1092038..1093207)
Genome map
AA seq 389 aa AA seqDB search
MEFKFGEYGGQYVPEVLIPSLKELEKAYKEYKDDPEFKAELDYYLKTYAGRETPLYFAEN
LTRKMGGAKIYLKREDLLLGGAHKINNSLGQALLAKKMGKTRLIAETGAGEHGLSTAMVG
ALFNMKTKIYMGAIDVERQKLNVYKMKLHGAEVEPVESGSKTLKDAINEALRDWVETFEN
THYLIGSAVGPYPYPSMVRDFQSVIGREAKKQILEAEGRLPDCIVACVGGGSNSIGIFNE
FRNDKEVQLVGVEAAGEGLDTERHAASLLRGKKGILHGMFSYFLQNNDGQIRETYSVSAG
LDYPGVGPEHAYLKDIGRVHYAGITDEEALNAFLELSRTEGIIPALESSHAVAQGMKMAK
EMDKDEIVIVNLSGRGDKDLGTVMKYIKF
NT seq 1170 nt NT seq  +upstreamnt  +downstreamnt
atggaatttaaatttggagaatatggcggtcaatatgttcctgaggtgcttataccctca
ttaaaggagctcgaaaaagcatataaagaatacaaagatgaccctgaatttaaggctgag
ctcgactattacctaaaaacctacgcaggtagggaaacccccttatattttgctgaaaac
cttacaagaaagatgggcggagcaaaaatatatttaaagagagaagatttacttttaggc
ggagctcataaaataaacaacagtttaggtcaggctcttcttgctaaaaaaatgggtaaa
acacgattaattgctgagactggtgcaggggaacatggtttatcaactgcaatggtagga
gctctatttaacatgaagacaaaaatttacatgggggcaatagatgtagaaaggcagaag
ttaaatgtttataagatgaaactacatggtgcagaagtagaacctgttgaatctggttca
aaaaccttaaaagatgccataaatgaggcacttagggactgggtagaaacatttgaaaat
acgcactatctaataggctctgctgttggtccatatccatatccttcaatggttagggat
ttccagtctgtaataggtagagaggctaaaaagcaaatattagaagcagagggaagactt
cctgattgtattgttgcctgcgtaggtggaggtagtaattcaataggtatattcaacgag
tttagaaatgataaagaagttcaacttgtaggtgttgaggctgctggtgaaggtcttgat
acagaaagacatgctgcttcactgttaaggggcaaaaaaggaatattgcatggtatgttc
tcatacttcttacagaataacgatggacagataagggaaacatacagtgtatccgctgga
ttggattatcctggtgtaggtcctgaacatgcctacttaaaagatataggaagagtgcat
tatgcaggaattacagatgaagaggcattaaatgcgttcttagagttatccagaacagaa
gggattataccagctcttgaatcatcccatgcagtagctcagggtatgaaaatggcaaaa
gaaatggataaagatgaaattgtaatagtaaatctctcaggaagaggagataaagattta
ggaactgttatgaaatatattaaattctaa

DBGET integrated database retrieval system