KEGG   Methanothermococcus okinawensis: Metok_1283Help
Entry
Metok_1283        CDS       T01534                                 

Definition
(GenBank) Aldehyde ferredoxin oxidoreductase
  KO
K11389  glyceraldehyde-3-phosphate dehydrogenase (ferredoxin) [EC:1.2.7.6]
Organism
mok  Methanothermococcus okinawensis
Pathway
mok00010  Glycolysis / Gluconeogenesis
mok01100  Metabolic pathways
mok01120  Microbial metabolism in diverse environments
mok01200  Carbon metabolism
mok01230  Biosynthesis of amino acids
Module
mok_M00001  Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
mok_M00002  Glycolysis, core module involving three-carbon compounds
Brite
KEGG Orthology (KO) [BR:mok00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Metok_1283
Enzymes [BR:mok01000]
 1. Oxidoreductases
  1.2  Acting on the aldehyde or oxo group of donors
   1.2.7  With an iron-sulfur protein as acceptor
    1.2.7.6  glyceraldehyde-3-phosphate dehydrogenase (ferredoxin)
     Metok_1283
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: AFOR_N AFOR_C DUF365
Motif
Other DBs
NCBI-ProteinID: AEH07251
UniProt: F8AJQ3
Position
1312420..1314351
Genome map
AA seq 643 aa AA seqDB search
MNILINASNKKYETINKEFFPINWGIYLHKKYETWKYDVYDEHNIFCFGRGVIPIIGGHR
LIFSFRSPLWDGFHFSAMGGAGYVFKNTGLHNVAIIGKCEKPSLLILDGEGEDLKVEFME
LNESNGFDIKNYKNIYDLNEYILKKFNEKNYRAFIVGPASLNTNMGGIFSQTVRNGKLVE
GSEDWAARGGVGSVLCRAHNILGVVYYGKNGTDEEVKKQKDIEKRLRNIVEEHYKKPYMT
VVLEHTKKYRYNEKTKTGGTFGNNYHYTLDITPIFNWRMPYIHKNDRIELHKKIMKYFVE
TFNKESIEPKKWTNCGEPCPVLCKKYRNGLKVDYEPYESNGPLLGIFDIHAADKIVHTVD
ALGFDAIEFGNLASYVFELLHVGLLKPEEVGIDKPIFDITHYQTDDDILKNSQYNAELAV
KLANIIAFKKNELAKILSLGKRKASKILNDKFKDRLMTKNADKFNYEKFEDFGVYIPFGD
NGEISPTQYWAIGNFMPYLIQGKYLTYYQCGEFLEPEELAKLSVERVIMEITIEDLGICR
FHRKWIYPIIKPLLKEITDVDLDSTIKELIKDICEYDKKIGYPPYIESQRVKDLIMAGAG
EFGNDKWALEFNSKGEVKLKEYIKRVMNEYSRLLNIDWKIKED
NT seq 1932 nt NT seq  +upstreamnt  +downstreamnt
atgaatattttaataaatgcttccaataaaaaatatgaaactataaataaagaatttttt
cccataaattggggaatatacctccataagaaatatgaaacctggaaatatgatgtttat
gatgaacataatatattctgctttggaagaggggttataccaataattggaggtcatagg
cttatattttctttcaggtctccactttgggatggattccatttctcagcaatgggaggt
gcaggatatgtatttaaaaacacaggattacataatgttgcaataattggaaaatgtgaa
aaaccaagtttattgatattggatggtgaaggagaagatttaaaagtagaatttatggaa
cttaacgaaagtaatggatttgatataaaaaattataaaaatatatatgatttgaatgaa
tatattctaaaaaaattcaatgaaaagaattatagggcatttattgtaggtcctgcatcg
ttaaatacaaatatggggggaatattctctcaaactgtaagaaacggaaagttagttgaa
ggctctgaggattgggctgcacggggtggtgtaggttctgtattatgccgagctcataac
atattaggggtggtatattatggtaaaaatggaacggatgaagaggtaaaaaaacagaag
gatattgaaaaaagactgaggaatattgtagaagaacactataaaaaaccgtatatgact
gttgttcttgaacatactaaaaaatacagatataatgaaaaaacaaaaacagggggaact
tttggaaataattaccattatacacttgatattacccctatatttaactggagaatgccc
tatattcataaaaatgatagaatagaacttcataaaaaaataatgaagtattttgtagaa
acatttaataaagaatccatagaacctaaaaaatggactaattgtggagaaccatgccct
gtattgtgcaaaaaatatagaaatggcttaaaagtggattatgaaccttatgagtccaat
ggtccattacttggtatatttgatatacatgccgcagataaaatcgtgcatactgtggat
gcccttggttttgatgccatagaatttggaaatttggcatcctatgtatttgaactactt
catgtggggcttttaaaaccagaggaagttgggatagataaacccatatttgatataaca
cactaccaaaccgacgatgatattttaaaaaattcgcaatataatgcagagctcgcagtg
aaacttgcaaatataatagcatttaaaaagaatgaactggctaaaatactatcacttgga
aaaagaaaggcatcaaaaatacttaacgataaatttaaagataggttaatgactaaaaat
gctgataaattcaattatgagaaattcgaagattttggtgtatatattccttttggtgat
aatggagagatatccccaactcaatattgggctattggaaattttatgccttatttaatt
caagggaaatatttaacatattatcaatgtggggaattcttagaaccagaagaattggca
aaacttagtgttgaaagagttataatggaaataacaatagaagatttaggtatttgcaga
ttccacagaaaatggatttatccaataattaaaccacttttaaaggaaataaccgatgta
gatttagatagcacaattaaagaattaattaaggatatctgtgaatacgataaaaaaata
ggatatccaccctacatagaaagtcaaagagttaaagatttgataatggctggtgcaggg
gagtttggaaatgataagtgggcattggaatttaacagtaagggggaagtcaaactaaaa
gaatacataaaaagagttatgaacgaatacagtagattactaaatattgattggaaaata
aaggaagattaa

DBGET integrated database retrieval system