KEGG   Methanothermococcus okinawensis: Metok_1401Help
Entry
Metok_1401        CDS       T01534                                 

Definition
(GenBank) acetate/CoA ligase
  KO
K01895  acetyl-CoA synthetase [EC:6.2.1.1]
Organism
mok  Methanothermococcus okinawensis
Pathway
mok00010  Glycolysis / Gluconeogenesis
mok00620  Pyruvate metabolism
mok00640  Propanoate metabolism
mok00680  Methane metabolism
mok00720  Carbon fixation pathways in prokaryotes
mok01100  Metabolic pathways
mok01110  Biosynthesis of secondary metabolites
mok01120  Microbial metabolism in diverse environments
mok01130  Biosynthesis of antibiotics
mok01200  Carbon metabolism
Module
mok_M00357  Methanogenesis, acetate => methane
mok_M00617  Methanogen
Brite
KEGG Orthology (KO) [BR:mok00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Metok_1401
   00620 Pyruvate metabolism
    Metok_1401
   00640 Propanoate metabolism
    Metok_1401
  Energy metabolism
   00720 Carbon fixation pathways in prokaryotes
    Metok_1401
   00680 Methane metabolism
    Metok_1401
Enzymes [BR:mok01000]
 6. Ligases
  6.2  Forming carbon-sulfur bonds
   6.2.1  Acid-thiol ligases
    6.2.1.1  acetate---CoA ligase
     Metok_1401
Lipid biosynthesis proteins [BR:mok01004]
 Acyl-CoA synthetase
  Short/medium chain acyl-CoA synthetase
   Metok_1401
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: AMP-binding AMP-binding_C ACAS_N
Motif
Other DBs
NCBI-ProteinID: AEH07366
UniProt: F8AK06
Position
complement(1445455..1447356)
Genome map
AA seq 633 aa AA seqDB search
MKSGDKYIPLEKLNSIKKEALENPEKFWGEQAKCLDWNKTWDKVLEWHVPYAKWFINGRL
NACYNCVDRHILNNRRNKAAIIWEGENGECRILTYYELYREVNKFANVLQNLGVETGDRV
AIYMPMIPEAAIAMLACARIGAIHSVVFSGFSADALAERINDAEAKVLITSDILYRRGKK
IDLKGIVDKALLNCPTINHTVYVKRNNDLKLMEGRDYCWDELMKGAKNYVEPVPVEANHP
LFILYTSGTTGKPKGVVHSTGGFMVYTTKTLEWTWGINDMDVFWCTADIGWITGHSYVVY
APLACGTTIVMYEGAIDYPNPGRIWEIIEKHGVTILYTAPTAIRMLMMYGEEWVKKYNLS
TLRMLGSVGEPINPRAWKWYYEVVGQKRCPICDCYWQTETGGHVIYPPIGIQDIPLKPGS
ATFPGIGIDADVVDEYGNSLPPNKRGLLVIKNPWPGMLMGLWKNDARYRAAYWERIKNCY
CPSDYAIKDEDGYFWILGRADEVLNVAGHRIGTAEVEHVLISHPAVAESAVIGKPDDIKG
EVPVAFVVLNKGYQNKKELKEELIHYVKETMGPIATPHMILFVNKLPKTRSGKIMRRILK
KLIMGEELGDLSTIEDNTSVDEIRKELSDFKYL
NT seq 1902 nt NT seq  +upstreamnt  +downstreamnt
atgaaatctggggataaatatatacctctggaaaaattaaatagtataaaaaaagaagca
ctggaaaatcctgaaaaattttggggggaacaagcaaaatgtttagattggaacaaaaca
tgggataaagttttagagtggcatgttccctatgcaaaatggtttattaatggaaggttg
aatgcctgttataattgtgtagatagacatatactaaacaatagaagaaataaggctgcc
ataatatgggaaggagaaaatggagaatgtaggatattaacatactatgaattgtataga
gaggttaataaatttgcaaatgttttgcagaatttaggtgtagagactggcgatagggta
gcaatatatatgcccatgataccagaagctgcaatagctatgcttgcatgtgcaaggatt
ggggctatacattcagtggtattttcaggattttcagctgatgcacttgcagaacgaata
aatgatgcagaggcaaaggttttgataacttccgatatactttatagaaggggtaaaaaa
atagatttaaagggtatagttgataaggcacttttaaactgccccactataaatcatacg
gtatatgtaaaaagaaataacgatttaaaattgatggaaggaagggactattgctgggat
gagctcatgaagggggcaaaaaattatgtagaacctgtgcctgtggaagcaaatcatccg
ctatttatattatatacgagcggaactactggaaaaccaaaaggggttgtgcattcaaca
ggaggatttatggtttataccacaaaaacacttgaatggacatggggcattaacgatatg
gatgtgttttggtgcacagcagatattggatggataacaggacatagttatgtggtatat
gcaccgttggcatgtggaactactattgtaatgtatgaaggggcaatagattatccaaat
cctggaagaatatgggaaattatagaaaaacatggagttaccatattatatactgcccca
acggcaataaggatgttgatgatgtatggggaagaatgggtaaaaaaatataatttatcc
acccttagaatgcttggaagcgttggagaaccgataaacccaagggcttggaaatggtat
tacgaagttgtaggtcagaaaagatgtccaatatgtgattgttattggcagacagaaacg
ggaggtcatgttatatatccaccaataggcatacaagatattcctttaaaaccaggttca
gccacattccccggcataggtatagatgctgatgtagtggatgaatatggaaatagtctt
ccaccaaataaaagggggttgttggtcattaagaatccatggcctggaatgttgatggga
ttatggaagaacgatgcacggtatagggcagcatattgggaaagaataaaaaattgttat
tgtccatcagattatgctataaaggatgaagatggatatttctggatattaggtagggct
gatgaggttttaaatgtagcagggcataggataggaacagcagaagttgaacatgttctc
atctcccatcccgcagttgcagaaagtgcagttattggaaaaccagacgatattaaagga
gaagttccagtggcatttgtggtattaaacaaaggttatcaaaataaaaaggaattgaag
gaagagctcatacattatgtgaaagaaacaatgggtcctattgccacaccacacatgatt
ttatttgtaaataaactccctaaaacaagaagtggaaaaattatgagaagaatacttaaa
aaactaataatgggagaagaattaggggatttatctaccatagaagataatacaagtgta
gatgaaatcagaaaagaattaagtgattttaaatatttataa

DBGET integrated database retrieval system