KEGG   Methanobrevibacter olleyae: YLM1_1383Help
Entry
YLM1_1383         CDS       T04385                                 

Definition
(GenBank) methyl-coenzyme M reductase beta subunit McrB
  KO
K00401  methyl-coenzyme M reductase beta subunit [EC:2.8.4.1]
Organism
mol  Methanobrevibacter olleyae
Pathway
mol00680  Methane metabolism
mol01100  Metabolic pathways
mol01120  Microbial metabolism in diverse environments
mol01200  Carbon metabolism
Module
mol_M00567  Methanogenesis, CO2 => methane
mol_M00617  Methanogen
Brite
KEGG Orthology (KO) [BR:mol00001]
 09100 Metabolism
  09102 Energy metabolism
   00680 Methane metabolism
    YLM1_1383
Enzymes [BR:mol01000]
 2. Transferases
  2.8  Transferring sulfur-containing groups
   2.8.4  Transferring alkylthio groups
    2.8.4.1  coenzyme-B sulfoethylthiotransferase
     YLM1_1383
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: MCR_beta MCR_beta_N
Motif
Other DBs
NCBI-ProteinID: AMK15940
UniProt: A0A126R0P5
Position
complement(1668246..1669577)
Genome map
AA seq 443 aa AA seqDB search
MAKFDDKVDLYDDRGSLVEADVPIEALSPLRNPAIKDIISGVKRTVAVNLEGIEKSLKTA
SVGGAKSKILGREIDLDVVGQADSIAASVKEMLQVNEGDDTVSQVLSGGKRILVQIPTIR
LDSSAEYSVATLATATALTQAIINEFDVDMYDANMVKAAILGRYPQSVEYMGSNIKTMLD
IPQKLEGPGYSLRNIKANDFVAATLKNTLQATALASIFEQTAMFEMGDAVGAFERMHLLG
LAYQGLNADNMVLGLVQDNAKDGTVGSIVQDTIAKAEADDVIAVEKELTDFNMYATNDTA
KWNAYAAAGCTAAVMVNVGAARAAQGIPSTILYFNDNIEFATGLPGIDFGRAEGVAVGFS
FFSHSIYGGGGPGLFNGNHVVTRHSKGFTIPCVAAGMALDAGTQLFSPEATSGLIKEIYS
EIDEFREPLKYVALAAADIKGDI
NT seq 1332 nt NT seq  +upstreamnt  +downstreamnt
ttggcaaagtttgatgataaagtcgatttatacgacgatagaggttcattagtggaagct
gatgtaccaatcgaggctctaagtccgttacgtaatcctgctattaaagatattattagc
ggtgtaaaaagaactgtagctgtaaacttagaaggtatcgagaaatctttaaaaactgct
tccgttggtggagcaaaatctaaaatcttaggaagagaaatagatcttgatgttgttggt
caagcagattctattgctgcttctgtaaaagaaatgcttcaagtaaatgaaggcgatgac
actgtatctcaagtactttctggtggaaaaagaattttagttcaaattccaactatcaga
ttagattcttcagcagaatattctgttgctactttagctactgctactgcattaactcaa
gctattattaacgagtttgatgtagatatgtacgatgcaaatatggttaaagctgcaata
ttaggaagatacccacaatctgtagaatatatgggatctaacataaaaaccatgttagac
attccacaaaaattagaaggtcctggttactctttaagaaacattaaagcaaacgacttc
gttgctgctactttgaaaaatactttacaagctactgcacttgcaagtattttcgaacaa
actgctatgtttgaaatgggtgatgcagtaggtgctttcgaaagaatgcacttattaggt
ttagcttatcaaggattaaatgcagacaacatggtattaggtttagtacaagacaatgca
aaagatggaactgtaggttctattgtacaagataccattgctaaagctgaagcagatgat
gtaattgctgtcgaaaaagaattaaccgatttcaacatgtatgcaactaatgacacagct
aaatggaatgcatatgctgctgctggttgtactgctgctgtaatggttaacgtaggtgca
gcaagagctgctcaaggtattccatctactattctttacttcaatgacaacattgaattc
gctactggtttaccaggtattgactttggtagagcagaaggtgtagctgttggattctct
ttcttctctcactctatctatggtggaggaggtcctggtttattcaacggtaaccacgta
gtaaccagacacagtaaaggatttactattccttgtgtagctgcaggtatggcattagat
gctggtacccaactcttctctccagaagctacttctggattaattaaagagatttacagt
gagattgatgaattcagagaaccactcaaatatgttgctttagcagctgctgatataaaa
ggtgacatctaa

DBGET integrated database retrieval system