KEGG   Microbacterium oleivorans: BWL13_01127Help
Entry
BWL13_01127       CDS       T05832                                 

Gene name
glgM
Definition
(GenBank) Alpha-maltose-1-phosphate synthase
  KO
K16148  alpha-maltose-1-phosphate synthase [EC:2.4.1.342]
Organism
moo  Microbacterium oleivorans
Pathway
moo00500  Starch and sucrose metabolism
moo01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:moo00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00500 Starch and sucrose metabolism
    BWL13_01127 (glgM)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01003 Glycosyltransferases [BR:moo01003]
    BWL13_01127 (glgM)
Enzymes [BR:moo01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.1  Hexosyltransferases
    2.4.1.342  alpha-maltose-1-phosphate synthase
     BWL13_01127 (glgM)
Glycosyltransferases [BR:moo01003]
 Polysaccharide
  Storage polysaccharide
   BWL13_01127 (glgM)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Glyco_transf_4 Glycos_transf_1 Glyco_trans_1_4 Glyco_trans_4_4 Glyco_trans_1_2 Glyco_transf_5 Glyco_trans_4_2 DUF3492
Motif
Other DBs
NCBI-ProteinID: AZS43567
UniProt: A0A031FXF6
Position
1157585..1158778
Genome map
AA seq 397 aa AA seqDB search
MRVDIVTKEYPPEIYGGAGVHVTELVSALRSRMEVQVRAFGEARDEADTTSYAVPAGLAE
ANAAVQTLGTDLEIVGDVAGADVVHSHTWYANFAGFLASKLHGIPHVVTAHSLEPLRPWK
AEQLGGGYAVSSYVERTAYENAAAVVAVSDGMRRDILRSYPALDPAKVRVIYNGIDVDAW
QPREDPELLSRWGIDPSRPSVVFVGRITRQKGLPYFLRAAELLPPEVQLVLCAGAPDTPE
IMAEVQGLVRQLQQTREGVVWIEEFLPRPDLCAILTSATTFVCPSVYEPLGIVNLEAMAC
GAAVVGTATGGIPEVVIDGVTGRLVPIDQVEDGTGTPVDPDRFVADLAATLTEVVSDPEK
AKAYGRAGRERAASAFSWEAIADATAELYREVAATGR
NT seq 1194 nt NT seq  +upstreamnt  +downstreamnt
atgcgcgtcgacatcgtcacgaaggagtacccgccggagatctacggcggagcgggagtc
cacgtcaccgaactcgtgtcggcgttgcgttcacgcatggaagtccaggtccgagccttc
ggtgaggcacgcgacgaagccgacaccacctcgtacgcggtgcccgccggtctcgccgag
gcgaacgccgccgtgcagaccctcggtaccgacctcgagatcgtgggagacgtcgccggg
gccgacgtcgtgcacagccacacctggtacgcgaacttcgccggtttcctcgcttcgaag
ctccacggcatccctcatgtcgtcacggcccactccctcgagccgctccggccgtggaag
gccgagcagctcggcggcggctacgcggtgtcgagctacgtcgagcggacggcctacgag
aacgccgctgccgtcgtcgccgtcagcgacgggatgcggcgcgacatcctccgcagctat
cccgccctcgaccccgccaaggtgcgcgtcatctacaacggcatcgacgtcgacgcctgg
cagccgcgggaagacccggagctcctctcgcgctgggggatcgacccgtcccgaccctcg
gtcgtcttcgtcggccggatcactcgtcaaaagggcctgccgtacttcctgcgcgccgcc
gagctcctgccgcccgaggtccagctcgtcctctgtgccggtgcccccgacactcccgag
atcatggccgaggtgcagggcctcgtccggcagctccagcagacacgtgaaggcgtcgtc
tggatcgaagagttcctcccgcgtcccgacctgtgcgcgatcctcacctccgcgacgacc
ttcgtctgcccgtccgtctacgagcccctcgggatcgtcaacctcgaagccatggcgtgc
ggcgctgcggtggtcgggacggcgaccggcggcatcccggaggtcgtcatcgacggcgtc
acaggccgtctcgtcccgatcgaccaggtcgaggacggcaccggaacgccggtcgacccc
gatcgtttcgtcgccgacctcgccgcgacactgaccgaggtcgtctccgatcccgagaag
gcgaaagcctacggccgcgcaggacgcgagcgcgccgcatccgcgttcagctgggaagcg
atcgcggatgccacggcagagctgtaccgcgaggtcgccgcgaccggccgctag

DBGET integrated database retrieval system