KEGG   Microbacterium oleivorans: BWL13_01673Help
Entry
BWL13_01673       CDS       T05832                                 

Definition
(GenBank) Hydrolase
  KO
K11206  deaminated glutathione amidase [EC:3.5.1.128]
Organism
moo  Microbacterium oleivorans
Brite
KEGG Orthology (KO) [BR:moo00001]
 09190 Not Included in Pathway or Brite
  09191 Unclassified: metabolism
   99980 Enzymes with EC numbers
    BWL13_01673
Enzymes [BR:moo01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.1  In linear amides
    3.5.1.128  deaminated glutathione amidase
     BWL13_01673
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: CN_hydrolase
Motif
Other DBs
NCBI-ProteinID: AZS44090
Position
complement(1679778..1680587)
Genome map
AA seq 269 aa AA seqDB search
MTGATIGVAVAQFAPAADESANLEVIATLVARARSRGAKVVLFPEYSSYFVDPFDASLAE
HAQDLDGPFVTALTALASEHDVHIVAGLVERADTKGHVRNTVVAVDAGGVVARYRKLHLY
DAFGQRESDWVEPGALEAPQTFELEGIRFALMTCYDLRFPEVSRVLADTGAHVILVAAEW
VRGPLKEDHWRTLLHARAIENTLYVAGADHPPPLGVGHSVVVDPQGVPVVSIGTSTDVAV
AFVDPAIVHRVRRVNPALALRRYTVTPRD
NT seq 810 nt NT seq  +upstreamnt  +downstreamnt
atgaccggggcaaccatcggcgtcgcggtggcgcagttcgcgcccgccgccgacgaatcc
gccaatctcgaggtgatcgcgaccctcgtcgctcgtgcccggtcgcggggcgcgaaggtc
gtgctgttccccgagtactcgagctatttcgtggaccctttcgacgcatcgctggcggag
cacgcgcaggacctcgacggcccgttcgtgaccgccctcaccgccctggcgtccgagcac
gacgtgcacatcgtcgccgggctcgtggaacgagccgacaccaagggacacgtccggaac
accgtcgtggccgtggatgccgggggcgtcgtcgcgcgctatcgcaagctccacctgtac
gacgcgttcgggcagcgtgagtcggattgggtggaacccggagccctggaagcgccccag
accttcgagctcgagggaatccgcttcgctctgatgacctgttacgacctgcgattcccc
gaggtgtcgcgcgtcctcgccgacacgggcgcccacgtcatcctcgtcgcggcggagtgg
gtgcgcggcccgctcaaggaagaccactggcggaccctcctgcacgcccgtgccatcgag
aacacgctctacgtcgccggggcggatcacccgccgccgctcggcgtggggcactccgtc
gtcgtcgatcctcagggcgtccccgtcgtctccatcggaacctccaccgacgtcgccgtg
gccttcgtcgatccggcgatcgtccaccgcgtccggcgggtgaaccccgcgctcgcgctc
cggcggtacaccgtcaccccgcgggactga

DBGET integrated database retrieval system