KEGG   Microbacterium oleivorans: BWL13_02143Help
Entry
BWL13_02143       CDS       T05832                                 

Gene name
metX
Definition
(GenBank) Homoserine O-acetyltransferase
  KO
K00641  homoserine O-acetyltransferase/O-succinyltransferase [EC:2.3.1.31 2.3.1.46]
Organism
moo  Microbacterium oleivorans
Pathway
moo00270  Cysteine and methionine metabolism
moo00920  Sulfur metabolism
moo01100  Metabolic pathways
moo01110  Biosynthesis of secondary metabolites
moo01130  Biosynthesis of antibiotics
Brite
KEGG Orthology (KO) [BR:moo00001]
 09100 Metabolism
  09102 Energy metabolism
   00920 Sulfur metabolism
    BWL13_02143 (metX)
  09105 Amino acid metabolism
   00270 Cysteine and methionine metabolism
    BWL13_02143 (metX)
Enzymes [BR:moo01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.31  homoserine O-acetyltransferase
     BWL13_02143 (metX)
    2.3.1.46  homoserine O-succinyltransferase
     BWL13_02143 (metX)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Abhydrolase_1 Hydrolase_4 Esterase
Motif
Other DBs
NCBI-ProteinID: AZS44552
Position
2161318..2162520
Genome map
AA seq 400 aa AA seqDB search
MDWQTSEDTVPSAPVTEADARLLLGRPPATGAWRDGDPIGERRFAQFGAFSTEGGASLPG
IRLAYETWGELSPARDNAVLILHALTGDSHVRGEAGPGHATDGWWGDIVGPGAPIDTDRW
FVVAPNILGGCQGSTGPASIAPDGYEWGSRFPFLTIRDQVAAQVMLADALGIDVWAGVVG
GSMGGMHALEWAVGHPERVERLGVLCSPPTTTADQVALNSVQIAAIQMDPRFAGGNYYDA
PDGDGPHRGLALARRMALLNYRTPTELNQRFQRSWQSEKSPFGEGGRYAVESYLDFHGNR
FTRRFDANSYLALVEAMNSHDVGRDRGGVEDALARVTARTLVLGVDSDRLFPVEGQHRIS
RGVRTTIDDETVVLRSDFGHDGFLIETEPVGRHLRRLLDS
NT seq 1203 nt NT seq  +upstreamnt  +downstreamnt
atggattggcagacctcggaagacacggtgccctcggcccccgtgaccgaggcagacgct
cggctcctgctcggccgcccgcccgcgacgggcgcgtggcgcgacggcgacccgatcggc
gagcgcaggttcgcgcagttcggcgccttctcgaccgagggcggggcgagccttcccggc
atccgtctcgcctacgagacgtggggcgagctctcccccgcccgcgacaacgcggtcctg
atcctgcacgcgctcaccggcgacagccacgtgcgcggcgaggcaggccccggtcacgcg
acagacggctggtggggcgacatcgtcggccccggcgccccgatcgacaccgaccgctgg
ttcgtcgtcgcgccgaacatcctggggggatgccagggctcgaccggtcccgcaagcatc
gctccggacggttacgaatggggctcgcgcttcccgttcctgacgatccgcgaccaggtc
gccgcgcaggtcatgctggccgacgcgctcggcatcgacgtctgggcgggagtggtcggc
ggctcgatgggcggcatgcatgcgctcgagtgggcggtcggccatcccgagcgggtcgag
cgcctcggggtgctgtgctcacccccgaccacgaccgccgaccaggtcgcgctcaactcg
gtgcagatcgccgcgatccagatggacccgcgcttcgccggcggcaactactacgacgct
cccgacggcgacgggccccaccggggactcgcgctcgctcgccggatggcccttctcaac
taccggacgcccaccgaactcaaccagcgcttccagcgctcctggcagtcggagaagagc
ccgttcggcgagggcggccggtacgcggtcgagagttacctcgacttccacggcaaccgc
ttcacgcgtcgtttcgacgcgaactcctacctcgctctcgtcgaggcgatgaactcgcac
gacgtcggccgcgatcgcggcggtgtcgaggacgccctcgcccgcgtgaccgcgcgcacc
ctggttctcggagtcgacagcgaccggctgttccccgtggaggggcagcaccgcatcagc
cgcggcgtccgcaccaccatcgacgacgagaccgtcgtgctgcgaagcgatttcggacac
gacgggttcctcatcgagactgagcccgtcggccgccacctgcgtcgcctgctcgacagc
tga

DBGET integrated database retrieval system