KEGG   Mesorhizobium opportunistum: Mesop_0394Help
Entry
Mesop_0394        CDS       T01542                                 

Definition
(GenBank) phosphoenolpyruvate carboxykinase (ATP)
  KO
K01610  phosphoenolpyruvate carboxykinase (ATP) [EC:4.1.1.49]
Organism
mop  Mesorhizobium opportunistum
Pathway
mop00010  Glycolysis / Gluconeogenesis
mop00020  Citrate cycle (TCA cycle)
mop00620  Pyruvate metabolism
mop00710  Carbon fixation in photosynthetic organisms
mop01100  Metabolic pathways
mop01110  Biosynthesis of secondary metabolites
mop01120  Microbial metabolism in diverse environments
mop01130  Biosynthesis of antibiotics
mop01200  Carbon metabolism
Module
mop_M00003  Gluconeogenesis, oxaloacetate => fructose-6P
Brite
KEGG Orthology (KO) [BR:mop00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Mesop_0394
   00020 Citrate cycle (TCA cycle)
    Mesop_0394
   00620 Pyruvate metabolism
    Mesop_0394
  09102 Energy metabolism
   00710 Carbon fixation in photosynthetic organisms
    Mesop_0394
Enzymes [BR:mop01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.49  phosphoenolpyruvate carboxykinase (ATP)
     Mesop_0394
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PEPCK_ATP
Motif
Other DBs
NCBI-ProteinID: AEH84889
UniProt: F7Y1R1
Position
complement(430093..431703)
Genome map
AA seq 536 aa AA seqDB search
MSEVGTRNPACAIDRIGLKTSGVVRYNFGAAALYEESIRRNEARLTAHGALVAETGQHTG
RSPKDKFVVRDAATEPHVWWDNNRAISPAQFETLLADFRAHAADKDLYVQDLVGGADAEL
KLPTRVITEFAWHSLFIRNLLIRPGKAELEQFLPEMTIIDLPSFRADPARHGSRTETVIA
VDLTRKIVLIGGTSYAGEMKKSVFTMLNYLLPEKGVMPMHCSANEGAGGDAAIFFGLSGT
GKTTLSADPSRTLIGDDEHGWGPHGIFNFEGGCYAKTIKLSAEAEPEIFATTQRFGTVLE
NVILDADGAPDFNDGRLTENTRCAYPLDFIPNASKTGRASHPKNIIMLTADAFGVMPPIA
RLTPAQAMYHFLSGYTAKVAGTEKGVTEPEATFSTCFGAPFMPRHPSEYGNLLRELIALH
GADCWLVNTGWTGGAYGTGKRMPIKATRALLAAALDGSLKATEFRTDANFGFEVPVTVPG
VDSAILDPRSTWADKAGYDRQAARLVGMFAVNFEKFESHVDAVVLGAAPRMQEAAE
NT seq 1611 nt NT seq  +upstreamnt  +downstreamnt
atgtcggaagtcggcacacgcaatcctgcttgcgcgatcgatcgtatcggcctgaaaacc
tctggcgtggtgcgctacaatttcggtgcggctgccctttatgaggaatcgatccggcgc
aatgaggcccggctgaccgcgcatggcgcgctggtcgccgagaccggccagcacacaggc
cgttctcccaaggacaagttcgtggtccgcgacgctgccaccgagccgcatgtttggtgg
gacaacaacagggcgatctcgccagcccagttcgaaacgctgctcgccgatttccgcgcc
cacgccgcggacaaggatctttatgtacaggacctggtcggcggcgccgatgccgagctg
aagctgcccaccagggtgatcaccgaattcgcctggcactcgctgttcatccgcaatctt
ctgatccgtccgggcaaggcggaactcgagcagttcctgcccgagatgacgattatcgac
ctgccgtccttccgcgccgatcccgcccgccacggcagccgcaccgaaacggtgatcgcc
gtcgacctgacccgcaagatcgtgctgatcggcggcacctcctatgccggcgagatgaag
aagtcggtgttcaccatgctcaactatctgttgccggaaaaaggcgtgatgccgatgcac
tgctcggccaatgaaggtgccggcggcgacgccgccatcttcttcggcctgtcgggcacc
ggcaagaccacgttgtcggccgatccgtcgcgcacgctgatcggcgacgacgagcatggc
tgggggccgcacggcatcttcaatttcgaaggcggctgctacgccaagacgatcaagctg
tcggccgaagccgagccggagatcttcgccaccacgcagcgcttcggcaccgtgctggaa
aatgtcatcctcgacgccgatggcgcgccggatttcaacgacggccggctgaccgagaac
acgcgctgcgcctacccgctcgacttcatacccaatgcctcgaagaccgggcgcgccagc
catcccaagaacatcatcatgctgaccgccgacgctttcggcgtgatgccgccgatcgcg
cggctgacgccggcgcaggcgatgtatcacttcctgtccggctacaccgccaaggtggcc
ggaaccgaaaagggcgtcaccgagcccgaggcgacgttctcgacctgcttcggtgcgccg
ttcatgccgcgccatccgtcggaatacggcaatctgctgcgcgagctcatcgcccttcac
ggcgccgattgctggctggtcaacaccggctggaccggcggcgcctacggcaccggcaag
cgcatgccgatcaaggcgacgcgcgcgctgcttgccgccgctctcgatggctcgttgaag
gcaaccgaattccgcaccgacgccaatttcggcttcgaggtgccggtgaccgtgcctggc
gtcgacagcgccattctcgatccgcgctcgacgtgggccgacaaggctggctatgaccgg
caggcagcaaggctggtcggcatgttcgccgtcaacttcgagaaattcgaaagccatgtc
gatgccgtcgtactgggtgcggcaccccgtatgcaggaagcggcggaataa

DBGET integrated database retrieval system