KEGG   Mesorhizobium opportunistum: Mesop_0760Help
Entry
Mesop_0760        CDS       T01542                                 

Definition
(GenBank) malate synthase G
  KO
K01638  malate synthase [EC:2.3.3.9]
Organism
mop  Mesorhizobium opportunistum
Pathway
mop00620  Pyruvate metabolism
mop00630  Glyoxylate and dicarboxylate metabolism
mop01100  Metabolic pathways
mop01110  Biosynthesis of secondary metabolites
mop01120  Microbial metabolism in diverse environments
mop01200  Carbon metabolism
Module
mop_M00012  Glyoxylate cycle
Brite
KEGG Orthology (KO) [BR:mop00001]
 Metabolism
  Carbohydrate metabolism
   00620 Pyruvate metabolism
    Mesop_0760
   00630 Glyoxylate and dicarboxylate metabolism
    Mesop_0760
Enzymes [BR:mop01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.3  Acyl groups converted into alkyl groups on transfer
    2.3.3.9  malate synthase
     Mesop_0760
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Malate_synthase
Motif
Other DBs
NCBI-ProteinID: AEH85253
UniProt: F7Y7T4
Position
complement(811164..813335)
Genome map
AA seq 723 aa AA seqDB search
MTDRVEIAGLRIARELHDFVAGEALPGTGIEAAAFWNGFSAIVHDLAPKNRALLAKRDAM
QEKLDGWYRDNGAPIDMEAYKGFLKEIGYLVPEGPAFSVSTDKVDPEIAVVAGPQLVVPV
MNARYALNAANARWGSLYDALYGTDAIPETDGAGKGKGFNPARGAKVIAWAKDFLDESAP
LTTGKWAGVNGLSVAHGALKLGEGAGITTLADPKQFVGYRGDAANPQAVLLVRNGLHVEI
VIDRDNQIGRTDPAGIADVMLESALTTIQDCEDSVAAVDAEDKVVVYRNWLGLMKGDLAE
EITKGGKSFVRKLNPDRSYTAPVGGTLTVPGRSLMLVRNVGHLMTNPAILDRDGNEVPEG
IMDAAMTALIALHDVGPSGRRMNSRAGSMYVVKPKMHGPEEVAFAVEIFDRVEALLGMPG
NTIKMGIMDEERRTTVNLREAIRAAKDRVVFINTGFLDRTGDEIHTSMEAGPMIRKGDMK
QAAWISAYEAWNVDTGLECGLAGHAQIGKGMWAMPDLMAAMLAEKIAHPKAGANTAWVPS
PTAATLHATHYHKVDVHAVQAALKSRPKAKLDDILSVPVAVRPNWTPDEIQRELDNNAQG
ILGYVVRWIDQGVGCSKVPDINDVGLMEDRATLRISSQHIANWLRHKVCSQIQVRDSLQR
MAAIVDRQNVGDPLYRPMAPDFDGSIAFQAACDLVFKGTSQPNGYTEPVLHARRLELKAK
ATA
NT seq 2172 nt NT seq  +upstreamnt  +downstreamnt
atgaccgatcgcgtcgaaatcgccggattgcggattgcccgcgagctgcatgattttgtg
gctggcgaggcgttgcccggcaccggcatcgaagcggcggctttctggaacggtttttct
gccatcgtccacgacctcgcgccgaagaaccgggcgctgctggcaaaacgcgacgccatg
caggagaagctcgacggctggtatcgcgacaacggcgcccccatcgacatggaggcctac
aagggcttcctcaaggagatcggctatctcgtgcccgaggggccggccttcagcgtgtcg
acggacaaagtcgaccccgagatcgccgtcgtcgccggtccgcagctggtcgtgccggtg
atgaatgcccgctatgcgctcaacgccgccaatgcgcgctggggctcgctctacgatgcg
ctctacggcaccgatgccatccccgagaccgacggcgccgggaagggcaagggcttcaat
cccgcgcgcggcgccaaggtcatcgcctgggccaaggactttctcgacgagtccgcgccg
ctgaccacgggaaaatgggctggcgtcaacggcctctcggtggcgcacggcgcgctgaaa
ctgggtgagggcgccggcatcaccacgctcgccgatcccaagcagttcgtcggctatcgc
ggcgacgccgccaacccgcaagccgtgctgctggtcaggaacggcctgcatgtcgagatc
gtgatcgaccgcgacaatcagatcggccgcaccgatccggctggcattgccgatgtcatg
ctggagtcggcgctgaccaccatccaggactgcgaggattcggtcgccgcggtcgatgcc
gaagacaaggtcgtggtctaccgcaactggctcggcctgatgaaaggcgatctggccgaa
gagatcaccaagggcggcaagagctttgtccgcaaactcaatccggatcgctcttacacc
gcacccgtcggcggcacgctgaccgtgcccggccgttcgctgatgctggtgcgcaacgta
ggtcacctgatgaccaacccggcgatcctggaccgcgacggcaacgaagtgccagaaggc
atcatggacgccgcgatgacggcgctgatcgcgctgcacgatgtcgggccgagcgggcgg
cggatgaattcgcgcgcgggctcgatgtatgtggtgaagcccaaaatgcacgggccggag
gaagtcgccttcgccgtcgagattttcgaccgcgtcgaagccctgctcggcatgcccggg
aataccatcaagatgggcatcatggacgaggagcggcgtaccaccgtcaacctcagggaa
gcgatccgcgctgcgaaagatcgggtggtgttcatcaacaccggtttcctcgaccgcacc
ggcgacgagatacacacctcgatggaagccggcccgatgatccgcaagggcgacatgaag
caggccgcctggatttccgcctacgaggcctggaatgtcgacaccgggctcgaatgcggt
ctggccggccacgcccagatcggcaagggcatgtgggcgatgccggacctgatggcggcg
atgctggccgagaagatcgcccatcccaaggccggcgccaacaccgcctgggtgccgtcg
ccgacggcggcgacgctgcatgccacgcattaccacaaggtcgatgtccacgcagtgcag
gcggcgctgaagagccgcccgaaggcgaagctcgacgacatcctctcggtgccggtggcc
gtgcgtccgaactggacgcccgacgagatccagcgcgagctcgacaacaacgcgcagggg
attctgggctatgtcgtgcgctggatcgaccagggcgtcggctgctccaaagtgcccgac
atcaacgatgtcggcctgatggaagaccgcgccacgctgcgcatctcctcgcagcacatc
gccaactggttgcgccacaaggtgtgctcgcaaatccaggtgcgggattcgctgcaacgc
atggcggccatcgtcgaccgccagaatgtaggcgacccgctctaccggccgatggcgccc
gatttcgacggctcgatcgccttccaggccgcctgcgacctggtgttcaagggcaccagc
caacccaacggctacaccgagccggtgctgcacgcgcggcggctagagctgaaggcaaaa
gcgacggcctga

DBGET integrated database retrieval system