KEGG   Mesorhizobium opportunistum: Mesop_1031Help
Entry
Mesop_1031        CDS       T01542                                 

Definition
(GenBank) 2-oxoglutarate dehydrogenase, E2 subunit, dihydrolipoamide succinyltransferase
  KO
K00658  2-oxoglutarate dehydrogenase E2 component (dihydrolipoamide succinyltransferase) [EC:2.3.1.61]
Organism
mop  Mesorhizobium opportunistum
Pathway
mop00020  Citrate cycle (TCA cycle)
mop00310  Lysine degradation
mop01100  Metabolic pathways
mop01110  Biosynthesis of secondary metabolites
mop01120  Microbial metabolism in diverse environments
mop01130  Biosynthesis of antibiotics
mop01200  Carbon metabolism
Module
mop_M00009  Citrate cycle (TCA cycle, Krebs cycle)
mop_M00011  Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate
Brite
KEGG Orthology (KO) [BR:mop00001]
 Metabolism
  Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    Mesop_1031
  Amino acid metabolism
   00310 Lysine degradation
    Mesop_1031
Enzymes [BR:mop01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.61  dihydrolipoyllysine-residue succinyltransferase
     Mesop_1031
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 2-oxoacid_dh Biotin_lipoyl E3_binding
Motif
Other DBs
NCBI-ProteinID: AEH85517
UniProt: F7YC47
Position
1079429..1080721
Genome map
AA seq 430 aa AA seqDB search
MATEIRVPTLGESVTEATIGKWFKKVGDAIAVDEPLVELETDKVTVEVPAAAAGTLGEIT
AKEGETVGVGALLGMISAGGAGAAPANKQEAKPQAVAQASSPDAAHTTKQAAAETARIAG
DAGPVEPRTMPPAPAAAKLIAENNLSVDQLSGSGKRGQVLKGDVLDAISKGAPSQPAETP
KAAPAPVAMRAPSSGDDASREERVRMTKLRQTIARRLKEAQSTAAMLTTFNEVDMSAVMA
LRTKYKDVFEKKHGVKLGFMGFFTKAVTHALKEIPSVNAEIDGTDIIFKNYAHIGVAVGT
EKGLVVPVVRDADQMSIAEIEKEIGRLGIAARDGKLSVADMQGGTFTISNGGVYGSLMST
PILNAPQSGILGMHKIQDRPVVVGGQIVIRPMMYLALSYDHRIVDGKEAVTFLVRVKESL
EDPERLVLDL
NT seq 1293 nt NT seq  +upstreamnt  +downstreamnt
atggctaccgaaatccgcgttcccactctcggcgaatccgtcaccgaggcgaccattggc
aaatggttcaagaaggtcggcgatgccattgccgtcgacgagccgctggtcgagctcgaa
accgacaaggtgacggtggaggttccggccgccgccgcaggcacgctgggcgagatcacc
gccaaggaaggcgagacggtcggcgtcggcgccttgctggggatgatttcggcgggcggt
gctggcgctgcccccgcgaacaagcaggaggccaagccccaagcggtggcgcaggcgtcg
agccccgacgcggcgcacaccaccaagcaggccgccgccgagaccgccaggatcgccggc
gatgccggcccggtcgagccgcgcaccatgccgcccgcgccggccgccgccaaactgatc
gccgagaacaatctgtctgttgatcagctttccggctcgggcaagcgcggccaggtgttg
aagggcgacgtgctcgatgctatctcgaagggcgcgccgtcgcagccggccgagacgccg
aaggcggcaccagcaccggttgccatgcgtgcgccatcctccggcgacgacgcctcgcgc
gaggagcgcgtgcggatgaccaaattgcgccagaccatcgcgcgccggctcaaggaagcg
caatcgaccgcagccatgctgaccaccttcaacgaggtcgacatgtcggcggtgatggcg
ctgaggaccaagtacaaggacgtgttcgagaagaagcacggcgtgaagctcggcttcatg
ggcttcttcaccaaggccgtcacccacgcgctgaaggaaatcccctcggtcaatgccgag
atcgacggcaccgacatcatcttcaagaactacgcccatatcggcgtcgccgtcggcacc
gagaagggcctggtcgtgccggtcgtgcgtgatgccgaccagatgtcgatcgccgagatc
gagaaggagatcggccggctgggcatcgccgcgcgcgacggcaagctgtcggtcgccgac
atgcagggcggcacgttcaccatctccaatggcggcgtttacgggtcgctgatgtcgacg
ccgatcctcaacgcgccgcagtcgggcattctgggcatgcacaagatccaggaccggccg
gtggtggtcggtggccagatcgtgatccggccgatgatgtatttggcgctgagctacgac
caccgcatcgtcgacggcaaggaagcggtgaccttcctggtgcgagtcaaggaaagcctg
gaggatccggaacggctggtgctggatttgtga

DBGET integrated database retrieval system