KEGG   Mesorhizobium opportunistum: Mesop_2463Help
Entry
Mesop_2463        CDS       T01542                                 

Definition
(GenBank) Alpha/beta hydrolase fold-3 domain protein
  KO
K14731  epsilon-lactone hydrolase [EC:3.1.1.83]
Organism
mop  Mesorhizobium opportunistum
Pathway
mop00903  Limonene and pinene degradation
mop00930  Caprolactam degradation
mop01220  Degradation of aromatic compounds
Brite
KEGG Orthology (KO) [BR:mop00001]
 09100 Metabolism
  09109 Metabolism of terpenoids and polyketides
   00903 Limonene and pinene degradation
    Mesop_2463
  09111 Xenobiotics biodegradation and metabolism
   00930 Caprolactam degradation
    Mesop_2463
Enzymes [BR:mop01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.1  Carboxylic-ester hydrolases
    3.1.1.83  monoterpene epsilon-lactone hydrolase
     Mesop_2463
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Abhydrolase_3 Say1_Mug180 AXE1 Gly_kinase
Motif
Other DBs
NCBI-ProteinID: AEH86937
UniProt: F7YGZ1
Position
complement(2551629..2552546)
Genome map
AA seq 305 aa AA seqDB search
MSVEIHPEDERDRAVMQAMRTMLSTLPALEFSPVSRPAFEDLMQHTPAADGVSFERATVG
VVSGWWCRPETEATRAAILYLHGGAYVLGSAIGHRNFVSQIVQRAGAPAFIPDYRLAPEH
AFPAAIEDAQAAFTGLCDMDYEAIAMAGDSAGGGLALSLLALAAAKARQGTGVMPRCAAL
MSPWTDLALAGGSMLTRAESDPLVRRDELKKAADLCLKGADPTDPRASPLYQPLGGLPPL
LVHVGYDEILLDDSRRVVEAASNAGGEAALHIWEGMTHVFPSNLAQLQAAREAVDMVGAF
IRQHL
NT seq 918 nt NT seq  +upstreamnt  +downstreamnt
atgagcgttgaaatccaccccgaggacgagcgcgaccgcgcggtcatgcaggcgatgcgc
acgatgctgtccacgctgcccgcgcttgagttttcgccggtgtcgcgcccggctttcgaa
gacctgatgcaacacacgcctgccgccgacggcgtcagcttcgagagggcgacggtcgga
gtggtatcgggctggtggtgccggccagagaccgaggcaacccgcgccgcgatcctttac
ctgcacggcggcgcctatgttctgggctccgccatcggtcatcgcaacttcgtcagccag
atcgtgcaacgcgccggcgcgccggccttcattcccgactaccggctggcgccggagcat
gctttccctgccgccatcgaggatgcccaagccgcgttcaccggcctttgcgacatggac
tacgaggcgatcgcgatggccggcgattcggccggcggtggccttgccctgtctttgctg
gcgctggcggccgccaaagccaggcaaggcaccggcgtcatgccccgttgcgcagcgctg
atgtcgccatggaccgaccttgcgctggccggcggctcgatgctgacgagagcagaatcc
gatccgctggtgagacgcgacgagctgaaaaaggcggccgacctttgtctcaagggcgcc
gaccctaccgatccgcgcgcctcgccgctctatcagcctctgggcggcctgccgccgctg
ctggtccatgtcggctatgacgagatcctgctcgacgattcacgccgcgttgtcgaggca
gcgtcgaacgcgggtggcgaggcggcgctgcatatctgggaaggcatgacgcatgtcttt
ccctccaaccttgcccagttgcaggcagcgcgcgaagccgtcgacatggtgggagccttc
atccgccagcatctctag

DBGET integrated database retrieval system