KEGG   Mesorhizobium opportunistum: Mesop_2838
Entry
Mesop_2838        CDS       T01542                                 
Name
(GenBank) conjugal transfer protein; TrbB
  KO
K20529  type IV secretion system protein TrbD
Organism
mop  Mesorhizobium opportunistum
Pathway
mop02024  Quorum sensing
Brite
KEGG Orthology (KO) [BR:mop00001]
 09140 Cellular Processes
  09145 Cellular community - prokaryotes
   02024 Quorum sensing
    Mesop_2838
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02044 Secretion system [BR:mop02044]
    Mesop_2838
Secretion system [BR:mop02044]
 Type IV secretion system
  Trb secretion system protein
   Mesop_2838
SSDB
Motif
Pfam: VirB3 MAPEG
Other DBs
NCBI-ProteinID: AEH87296
UniProt: F7Y4H6
Position
2943413..2943694
AA seq 93 aa
MTTVLEQLDAVPGWSAPVHRALTEQILLGGAPRAIAILNGTLAGAVGLGLRLWLVGLLIW
AIGHATAVWSVRRDPLFFEVGRRHLRLPGHLSV
NT seq 282 nt   +upstreamnt  +downstreamnt
atgacgaccgttctcgaacaactcgacgcggtgccggggtggtcggcgcctgtccatcga
gcgctgaccgagcagatcctgctcggcggcgcgccgcgcgcaatcgcgatcctgaacggc
acgcttgcgggcgccgtcggtcttgggctgcggctctggctggtcggcctgctcatctgg
gcaatcgggcatgctacggcggtttggtccgtcaggcgcgatccgctctttttcgaggtt
ggacgcaggcacctgcggctgcctgggcatttgtcggtttga

DBGET integrated database retrieval system