KEGG   Mesorhizobium opportunistum: Mesop_3950Help
Entry
Mesop_3950        CDS       T01542                                 

Definition
(GenBank) glycoside hydrolase family 3 domain protein
  KO
K01207  beta-N-acetylhexosaminidase [EC:3.2.1.52]
Organism
mop  Mesorhizobium opportunistum
Pathway
mop00520  Amino sugar and nucleotide sugar metabolism
mop01100  Metabolic pathways
mop01501  beta-Lactam resistance
Brite
KEGG Orthology (KO) [BR:mop00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00520 Amino sugar and nucleotide sugar metabolism
    Mesop_3950
 09160 Human Diseases
  09175 Drug resistance: antimicrobial
   01501 beta-Lactam resistance
    Mesop_3950
Enzymes [BR:mop01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.52  beta-N-acetylhexosaminidase
     Mesop_3950
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Glyco_hydro_3
Motif
Other DBs
NCBI-ProteinID: AEH88387
UniProt: F7Y3J4
Position
4057909..4059222
Genome map
AA seq 437 aa AA seqDB search
MFSINLVTGFFSALLMTSVAVAGPQAAQVKADAKTSDSKTADAKTAASRRLDDSSLRVMI
GQMILVGFNGVSADAASVVAVRQEIADGSIGGIMYLSDNVSDRTHVAAMNAAFLAANRKL
PPFISVDEEGGAIARLTADNGFHEVPAAVDVASKFSPRGAYELYSRLATDLREWGFNLNF
GPVADLNVNPANPIIGKLGRSFSANPEIVAQYGAAFVRAHRDAGVVTTLKHFPGHGSSST
DSHKGLADVSGTWSSQELIPFRKLINAGYADSVMVGHLYDRALQKGEAVGPASLSSAIVT
GLLRKDLGFEGVVFSDDLQMDAVENSYSFGGAVVRAVEAGDDILIFSNHKNPDADLPEKV
IDILMAEARRNPVVAANIVKSFAKISALKASLAQRGGPMIDLLSTKSITPDPGNEVTPAD
VEMVRRDMALKVVGLPG
NT seq 1314 nt NT seq  +upstreamnt  +downstreamnt
gtgttctccatcaacctggtaaccgggtttttttcggcgctgctgatgacttcggtggcc
gtcgcgggtccgcaggcggctcaggtgaaagccgatgccaagacgtccgactccaagacg
gccgatgccaagacggccgcttcgcgaaggctcgacgattcgagtctccgcgtgatgatt
ggccagatgatcctggtcggcttcaatggagtctcggccgacgcggcgtcggtggtcgcg
gtcaggcaagagatcgccgacggcagcatcggggggatcatgtatctttccgacaacgtc
agcgacagaacgcacgtggcggcgatgaacgcggcgtttctggccgccaatcggaagttg
ccgcccttcatttccgtcgatgaggagggaggggcaattgcaagattgacggctgacaac
ggatttcacgaggttccggccgccgtcgatgtcgccagcaagttctcgcctcgcggcgcg
tacgaactctactccaggctcgcgacggatttgcgtgaatggggcttcaacctcaatttc
ggtccggtggcggacctgaatgtgaatcccgccaatcccattatcgggaagttgggcagg
agcttttccgcgaacccggaaatcgtcgcccaatatggcgcggccttcgtaagggcacat
cgcgacgcgggtgtcgtaaccacgctcaagcattttcccgggcacggctcgagctcgacc
gatagccacaaggggctggcggacgtatccggcacctggtcgagccaggaactgattccg
tttcgcaaactgatcaatgcgggctacgcggactcggtcatggtgggccatctctacgac
cgcgccctgcaaaagggggaagccgtggggccagcctcgctctcatcggcgatcgttact
ggcctgctgcgcaaagaccttggcttcgaaggcgtcgtcttttcggacgacctgcaaatg
gacgccgtggaaaacagctattcgttcggtggcgcggttgtgcgcgccgtcgaggcggga
gacgatattctgatcttctcgaaccataagaacccggatgccgacctacccgaaaaggtc
atcgacatcctcatggctgaagcccgcaggaacccggtggtcgcggccaacatcgtgaag
tcgtttgccaagatatcggctctcaaggcaagtctcgcacagcggggtggtccaatgatc
gatctgctttcgaccaaatccatcacgcccgatccgggtaacgaggtcacgccggccgac
gtggagatggttcggcgcgacatggccttgaaggtcgttgggctgccgggctga

DBGET integrated database retrieval system