KEGG   Mesorhizobium opportunistum: Mesop_4516Help
Entry
Mesop_4516        CDS       T01542                                 

Definition
(GenBank) methionyl-tRNA synthetase
  KO
K01874  methionyl-tRNA synthetase [EC:6.1.1.10]
Organism
mop  Mesorhizobium opportunistum
Pathway
mop00450  Selenocompound metabolism
mop00970  Aminoacyl-tRNA biosynthesis
mop01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:mop00001]
 09100 Metabolism
  09106 Metabolism of other amino acids
   00450 Selenocompound metabolism
    Mesop_4516
 09120 Genetic Information Processing
  09122 Translation
   00970 Aminoacyl-tRNA biosynthesis
    Mesop_4516
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01007 Amino acid related enzymes [BR:mop01007]
    Mesop_4516
  09182 Protein families: genetic information processing
   03016 Transfer RNA biogenesis [BR:mop03016]
    Mesop_4516
Enzymes [BR:mop01000]
 6. Ligases
  6.1  Forming carbon-oxygen bonds
   6.1.1  Ligases forming aminoacyl-tRNA and related compounds
    6.1.1.10  methionine---tRNA ligase
     Mesop_4516
Amino acid related enzymes [BR:mop01007]
 Aminoacyl-tRNA synthetase
  Class I (U)
   Mesop_4516
Transfer RNA biogenesis [BR:mop03016]
 Eukaryotic type
  Aminoacyl-tRNA synthetases (AARSs)
   Multi-aminoacyl-tRNA synthetase complex (MSC)
    Mesop_4516
 Prokaryotic type
   Other AARSs
    Mesop_4516
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: tRNA-synt_1g tRNA-synt_1 tRNA-synt_1e tRNA-synt_1f Anticodon_1 SpoVS Herpes_ICP4_N
Motif
Other DBs
NCBI-ProteinID: AEH88939
UniProt: F7YCP9
Position
4647573..4649126
Genome map
AA seq 517 aa AA seqDB search
MSRDTFYITTAISYPNGKPHIGHAYEVIATDALARFQRLDGKQVFFLTGTDEHGIKMLQT
AKREGISARELADRNSADFKRMAAALNASNDDFIRTTEERHYASSQAIWKAMDANGDIYK
GGYAGWYSVRDEAYYGEEETEVRADNVRYGPQGTPVEWVEEESYFFRLSAYQDKLIALYE
SQPDFIGPAERRNEVMSFVKSGLKDLSISRTTFDWGVPVPGDEKHVMYVWVDALTNYITG
VGYPDEKDEKWRFWPADAHIIGKDIVRFHAVYWPAFLMSAGIPLPKRVFGHGFLFNRGEK
MSKSVGNVIDPFTMVEHYGLDQVRYFFLREVPFGQDGSYSHEAIVNRTNADLANGLGNLA
QRSLSMIAKNCGGVVPKRGDLTEADSAILDQAVAALATARKAMAGQGIHLALAAIFDVVA
EADRYFAGQAPWALKKTDPERMETVLWTTAEVVRRVTVLCQPFVPGSAAKLLDLLAVPAD
KRDFEHVHADHALVPGTALPVPEGVFPRYVEQPGVNA
NT seq 1554 nt NT seq  +upstreamnt  +downstreamnt
atgtcacgcgacacattctacatcacgaccgcgatttcctatccgaacggcaagccgcat
atcggccatgcctacgaggtgatcgccaccgacgcgctggcgcgcttccagcgcctcgac
ggcaagcaggtcttcttcctgacgggcaccgacgagcacggcatcaagatgctgcagacg
gccaagcgcgaaggcatttcggcgcgcgaactggccgaccgcaattcagccgatttcaag
cgcatggcggctgccctcaacgcttccaacgacgatttcatccgcaccacggaagaacgg
cactacgcctcatcgcaggcgatctggaaggcgatggacgccaatggcgacatctacaag
ggcggctatgccggctggtattcggtgcgcgacgaagcctattacggcgaggaggagacg
gaggtccgcgccgacaatgtccgctacggaccgcagggcacgccggtcgaatgggtagag
gaagagagctatttcttccgactgtcggcctatcaggacaagctgatcgcgctttatgaa
agccagcccgacttcatcggcccagccgagcgccgcaacgaggtgatgagcttcgtcaaa
tcggggttgaaggacctgtcgatctcgcgcaccactttcgattggggcgtgcctgtgccc
ggcgacgaaaagcacgtgatgtatgtctgggtcgacgcgctgacaaactacatcaccggc
gtcggctatcccgatgaaaaagatgagaaatggcgcttctggccagccgatgcccatatc
atcggaaaggacatcgtgcgcttccacgcggtctattggccggcgttcctgatgtcggcg
ggcatcccgctgccgaagcgcgtcttcggccacggcttcctgttcaaccgcggcgagaag
atgtcgaaatcggtcggcaacgtcatcgacccgttcaccatggtcgaacactacggtctc
gaccaggtgcgctacttcttcctgcgcgaagtgccgttcggccaggacggcagctacagc
catgaagcgatcgtcaatcgcaccaacgccgatctcgccaatgggctcggcaacctggcg
cagcgttcgctgtcgatgatcgccaagaactgcggcggcgtggtgccgaagcgtggcgac
ctgacggaggccgacagcgcgatcctcgatcaggcggtggcggctcttgccacggcccga
aaggccatggccgggcagggcattcatcttgcattggcggcgatcttcgatgtggtggcg
gaagccgatcgctacttcgccggacaggcaccatgggcgctgaaaaagaccgatccggag
cgcatggaaacggtgctgtggacgaccgccgaggtggtccggcgcgtgacggtgctgtgc
cagccctttgtcccgggatcggccgcgaagctgctcgatctgctggcggtgccggcggac
aagcgtgatttcgagcatgtccatgccgaccatgcgcttgtgcccggcacggcattgccc
gtgccggagggcgtctttccacgctatgtcgaacagccgggcgtgaacgcctga

DBGET integrated database retrieval system