KEGG   Mesorhizobium opportunistum: Mesop_5239Help
Entry
Mesop_5239        CDS       T01542                                 

Definition
(GenBank) guanylate kinase
  KO
K00942  guanylate kinase [EC:2.7.4.8]
Organism
mop  Mesorhizobium opportunistum
Pathway
mop00230  Purine metabolism
mop01100  Metabolic pathways
Module
mop_M00050  Guanine ribonucleotide biosynthesis IMP => GDP,GTP
Brite
KEGG Orthology (KO) [BR:mop00001]
 Metabolism
  Nucleotide metabolism
   00230 Purine metabolism
    Mesop_5239
Enzymes [BR:mop01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.4  Phosphotransferases with a phosphate group as acceptor
    2.7.4.8  guanylate kinase
     Mesop_5239
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Guanylate_kin AAA_33 AAA_16 AAA_18 AAA_22 Thymidylate_kin RsgA_GTPase AAA_29 cobW TsaE ABC_tran
Motif
Other DBs
NCBI-ProteinID: AEH89655
UniProt: F7Y630
Position
complement(5344808..5345482)
Genome map
AA seq 224 aa AA seqDB search
MVAKEPMVARDLGSRIRRRGLMLVLSSPSGAGKSTIARNLLESDSSLELSVSVTTRPRRG
SEIEGVHYHFRTMRDFERLRDSDALLEWAEVHGNCYATPREPAELALAQGRDMLFDIDWQ
GAQQLKEKMRADIVSIFILPPSMKELKARLKRRAEDQEAVIETRLKNARNEIEHWKEYDF
VIVNDDLDRAFAEVRGIVVAERLRRDRRPGLFDFVSGLLDEKTG
NT seq 675 nt NT seq  +upstreamnt  +downstreamnt
atggttgccaaggaaccgatggttgccagggatttgggctcccgcattcgtcgccggggg
ctgatgctcgtcctgtcgtcgccatccggcgccggcaagtcgaccatcgcgcgcaacctt
ctggaaagcgactccagcctcgaactgtcggtctcggtcaccaccaggccgcgtcgcggc
agcgagatcgagggtgttcactaccatttccgcacgatgcgcgacttcgaacggttgcgc
gattccgacgcgctgctcgagtgggccgaggtgcatggcaactgctatgcgacaccgcgc
gaacccgccgaactggcgctggcgcaaggccgcgacatgctcttcgacatcgactggcaa
ggcgcccagcagctcaaggagaagatgcgcgccgatatcgtctcgatctttatcctgccg
ccgtcgatgaaggaactgaaggcgcgcctgaagcgccgcgccgaggaccaggaagcggtg
atcgagacgcggctcaagaacgcccgcaacgagatcgagcactggaaggaatatgatttc
gtcatcgtcaatgacgacctcgatcgtgccttcgccgaagtgcgcggcatcgtcgtggcc
gagcggctgaggcgcgatcgtcggcctggtctgttcgatttcgtctctggcctgttggac
gaaaagaccggctga

DBGET integrated database retrieval system