KEGG   Mesorhizobium opportunistum: Mesop_5950Help
Entry
Mesop_5950        CDS       T01542                                 

Definition
(GenBank) Alcohol dehydrogenase GroES domain protein
  KO
K00004  (R,R)-butanediol dehydrogenase / meso-butanediol dehydrogenase / diacetyl reductase [EC:1.1.1.4 1.1.1.- 1.1.1.303]
Organism
mop  Mesorhizobium opportunistum
Pathway
mop00650  Butanoate metabolism
Brite
KEGG Orthology (KO) [BR:mop00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00650 Butanoate metabolism
    Mesop_5950
Enzymes [BR:mop01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.4  (R,R)-butanediol dehydrogenase
     Mesop_5950
    1.1.1.303  diacetyl reductase [(R)-acetoin forming]
     Mesop_5950
    1.1.1.-  
     Mesop_5950
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ADH_N Glu_dehyd_C ADH_zinc_N Sacchrp_dh_NADP Shikimate_DH ApbA TrkA_N FAD_binding_3
Motif
Other DBs
NCBI-ProteinID: AEH90357
UniProt: F7YHI4
Position
complement(6107209..6108270)
Genome map
AA seq 353 aa AA seqDB search
MKAARLYGPGDLRVEDIATPGIPDVGWVKLRVDAAGICGSDLHNFRTGQWISRSPSTAGH
ELTGTVIAIGEGVDTVSVGDRVVADSRFWCGDCAQCRAGRRHLCGSLGFVGEICDGAFAE
QAMLPARLLHVIDADLDERVAAMAEPLAVALHAVRRLPKTTGSVLVVGCGPIGGLAALLL
SQTFAGTVLVADRNQARCARVAQVTGATIVDLDRDAIAAATANAPLLAAVEATGSIAAFN
QLLGVLDSGSAVAMVGIFHGRLDIDPNLLVEREIALLGCHAFADELPDAVRMLGELSEPL
LALIDREIGLDEVPAAYERLLAGRSDGLKTIIRMRQPVEPALIFDKLAERILT
NT seq 1062 nt NT seq  +upstreamnt  +downstreamnt
atgaaggcggcacgactttatggccccggtgatctgcgcgtcgaagatatagccacgcca
gggattccggatgtgggctgggtgaagctcagggtcgatgccgccggcatctgcggttcg
gacctgcacaatttccgcaccgggcagtggataagccgctcgccatcgacggccggccat
gagctgaccggcacggtgatcgccatcggcgagggcgtcgataccgtctccgtcggcgac
agggtggttgccgattcccggttctggtgcggggactgcgcgcaatgccgcgccggcagg
cggcatctctgcgggtcgctgggtttcgtcggagaaatctgcgacggcgcctttgccgaa
caggccatgttgcccgcacgtctgctgcatgtcatcgatgccgaccttgacgagcgggtc
gcggcgatggccgagccgcttgcggtggcgctgcacgcggtgcggcgcctgccaaagacg
acgggctcggtgcttgttgtcggctgcgggccgattggcggtcttgccgcgctgctgctg
tcgcaaaccttcgccggcacggtgctggtcgccgaccgcaaccaggcccgctgcgcccgt
gtggcccaggtgactggagccacgattgtcgatctcgaccgcgatgccattgctgcggca
accgccaacgccccgctgctggcggccgtcgaggcgacgggcagcatcgccgcattcaac
cagttgctcggcgtgctcgattccggcagcgcggtggcgatggtcggcatcttccatggt
cgcctcgacatcgatcccaaccttctggtcgaacgcgagatcgctttgctgggatgccat
gccttcgccgacgaactgcccgacgcggtgcggatgctgggtgaactcagcgaaccgctg
ctcgccctgatcgatcgcgagatcggcctggacgaggttccggctgcttatgaacggctg
ttggcggggcgcagcgatggcttgaaaacaatcatccgcatgcggcaacctgttgagccc
gctttgattttcgacaaattggcggaaaggattttgacatga

DBGET integrated database retrieval system