KEGG   Mesorhizobium opportunistum: Mesop_6099
Entry
Mesop_6099        CDS       T01542                                 
Name
(GenBank) P-type conjugative transfer protein TrbJ
  KO
K20266  type IV secretion system protein TrbJ
Organism
mop  Mesorhizobium opportunistum
Pathway
mop02024  Quorum sensing
Brite
KEGG Orthology (KO) [BR:mop00001]
 09140 Cellular Processes
  09145 Cellular community - prokaryotes
   02024 Quorum sensing
    Mesop_6099
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02044 Secretion system [BR:mop02044]
    Mesop_6099
Secretion system [BR:mop02044]
 Type IV secretion system
  Trb secretion system protein
   Mesop_6099
SSDB
Motif
Pfam: DUF2150 DUF3253 DUF832
Other DBs
NCBI-ProteinID: AEH90501
UniProt: F7Y1E5
Position
complement(6261692..6262417)
AA seq 241 aa
MMRRRFLSGLITLSLMAKPMADYVQPAYALIVFDPSNYTQNVLTAARSLEQINNQIQSLQ
NQATMLQNMARNLQRLDFSSVGQLTGSLQRIDGLMDQASGLSFDLGKLQDQWRNQYPESY
DATIKVSDVASAARERWQSAMQAFRQTMGVQSQILDNVRGDRDLLADLVNRSQGAAGALE
ASQATNQLIALSTKQQMQIQTLLATQFRAEAEDAARKAQSEEAARQTTKRFLGTGTAYPG
N
NT seq 726 nt   +upstreamnt  +downstreamnt
atgatgcggcgccgtttcctttccggcctgatcaccctttccctgatggccaaaccgatg
gccgactatgtccagccagcctacgcgctcattgtcttcgatccctcgaactacacccag
aatgtgctgacggcggcacgctcactggagcagatcaataaccagatacagtcgctccag
aaccaggcgaccatgctacaaaacatggcgcgcaaccttcagaggctggatttttcttcg
gtgggccagctcaccggttcgctgcagcggatcgacgggctcatggaccaggcgagtggt
ctgagttttgatctgggcaagctgcaggaccagtggcgcaatcaatatcccgaaagctac
gacgccacgatcaaggtcagcgatgtggcaagcgcagcacgcgagcgctggcagagcgcc
atgcaggcgttccggcagacgatgggtgtccagtcgcaaatcctcgacaacgtccgcggc
gatcgcgacctgcttgctgatctcgtcaaccgcagccagggtgctgccggtgcgcttgag
gcaagccaggccaccaaccaactgatcgcgctctcaaccaagcagcagatgcagatccag
acgctgctcgcgacgcagtttcgcgctgaggccgaggatgcggctcgcaaagcgcagtcc
gaagaagccgcgcgccagacgacaaagcgtttcctcggcaccggcacggcctatcccggc
aactga

DBGET integrated database retrieval system