KEGG   Mesorhizobium opportunistum: Mesop_6631Help
Entry
Mesop_6631        CDS       T01542                                 

Definition
(GenBank) ApaG domain protein
  KO
K06195  ApaG protein
Organism
mop  Mesorhizobium opportunistum
Brite
KEGG Orthology (KO) [BR:mop00001]
 09190 Not Included in Pathway or Brite
  09193 Unclassified: signaling and cellular processes
   99994 Others
    Mesop_6631
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: DUF525
Motif
Other DBs
NCBI-ProteinID: AEH90952
UniProt: F7Y8U1
Position
6822941..6823333
Genome map
AA seq 130 aa AA seqDB search
MYRAVTRNIEVQVRPFYLEDRSDPSENRYVWGYQITIDNQSDEFVQLLSRYWHITDGTGR
VEEVSGPGVVGDQPELNPGDSYQYTSGCPLSTPSGIMVGRYTMRNKRGETFDIAIPAFSL
DLPGTRRTVN
NT seq 393 nt NT seq  +upstreamnt  +downstreamnt
atgtatcgcgccgtcacgcgcaacatcgaagtgcaggtcaggccgttctatctcgaggac
cgctcggatccttcggagaaccgctatgtctggggctatcagataacgatcgacaatcag
tcggacgagttcgtgcagcttctatcgcgttattggcacatcaccgacggcaccggccgg
gtcgaggaagtgagtgggccgggcgtcgtcggcgaccagcctgaactcaatcccggcgac
agctatcagtatacgtccggctgcccgctctcgaccccgtcagggatcatggtcggccgc
tacacgatgcgcaacaagcgcggcgagaccttcgacatcgccatcccggcattttcgctc
gacctgccggggaccaggcggacggtgaattag

DBGET integrated database retrieval system