KEGG   Mesorhizobium opportunistum: Mesop_6650Help
Entry
Mesop_6650        CDS       T01542                                 

Definition
(GenBank) acetyl-CoA acetyltransferase
  KO
K00626  acetyl-CoA C-acetyltransferase [EC:2.3.1.9]
Organism
mop  Mesorhizobium opportunistum
Pathway
mop00071  Fatty acid degradation
mop00072  Synthesis and degradation of ketone bodies
mop00280  Valine, leucine and isoleucine degradation
mop00310  Lysine degradation
mop00362  Benzoate degradation
mop00380  Tryptophan metabolism
mop00620  Pyruvate metabolism
mop00630  Glyoxylate and dicarboxylate metabolism
mop00640  Propanoate metabolism
mop00650  Butanoate metabolism
mop00900  Terpenoid backbone biosynthesis
mop01100  Metabolic pathways
mop01110  Biosynthesis of secondary metabolites
mop01120  Microbial metabolism in diverse environments
mop01130  Biosynthesis of antibiotics
mop01200  Carbon metabolism
mop01212  Fatty acid metabolism
mop02020  Two-component system
Brite
KEGG Orthology (KO) [BR:mop00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00620 Pyruvate metabolism
    Mesop_6650
   00630 Glyoxylate and dicarboxylate metabolism
    Mesop_6650
   00640 Propanoate metabolism
    Mesop_6650
   00650 Butanoate metabolism
    Mesop_6650
  09103 Lipid metabolism
   00071 Fatty acid degradation
    Mesop_6650
   00072 Synthesis and degradation of ketone bodies
    Mesop_6650
  09105 Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    Mesop_6650
   00310 Lysine degradation
    Mesop_6650
   00380 Tryptophan metabolism
    Mesop_6650
  09109 Metabolism of terpenoids and polyketides
   00900 Terpenoid backbone biosynthesis
    Mesop_6650
  09111 Xenobiotics biodegradation and metabolism
   00362 Benzoate degradation
    Mesop_6650
 09130 Environmental Information Processing
  09132 Signal transduction
   02020 Two-component system
    Mesop_6650
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:mop04147]
    Mesop_6650
Enzymes [BR:mop01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.9  acetyl-CoA C-acetyltransferase
     Mesop_6650
Exosome [BR:mop04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   Mesop_6650
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Thiolase_N Thiolase_C ketoacyl-synt ACP_syn_III_C
Motif
Other DBs
NCBI-ProteinID: AEH90971
UniProt: F7Y8W0
Position
complement(6842059..6843267)
Genome map
AA seq 402 aa AA seqDB search
MADAYVYDAVRTPRGKGKKDGSLHEVPAVRLAAKTLEALRDRNGLDTGNVDDIIFGCVDP
VGEAGSVIPRAAAFEAGYDDKAPGMQISRFCASGLDAINFGAAKIAQGADEIVIAGGVES
MSRVGMGASGGAWFMDPSVGLPGWFVPQGISADLIATKYGFSRDDVDAYAVESQKRAAKS
WADGRFKNSVIPIKDQNGLTILDHDEHMRPSTDMQSLASLNPSFVMPGEMGGFDAVAVQK
HPEVEEVNHVHHAGNSSGIVDGAAAVLLGSKRAGKTMGLKPRARIRTFANIGSEPVLMLT
GPVDVTEKLLKRAKMKLSDIDLFELNEAFASVVLRYMQAFDIPHDKINVNGGAIAMGHPL
GATGAMILGTVLDELERRDLNTALVTLCIGAGMGTATIIERV
NT seq 1209 nt NT seq  +upstreamnt  +downstreamnt
atggctgacgcttatgtctatgacgcggtgcgcacgccgcgcggcaagggcaagaaggac
gggtcgctgcacgaggtgccggcggtacggcttgccgccaagacgctcgaggctttgcgc
gaccgcaatgggctggataccggcaatgtcgacgacatcatcttcggctgcgtcgatccg
gtcggcgaggccggctcggtcattccgcgcgccgccgccttcgaggccggctacgacgac
aaggccccgggcatgcagatctcgcgcttctgcgcctccggtctcgacgccatcaatttc
ggcgccgccaagatcgcccagggcgccgatgagatcgtcatcgccggtggcgtcgaatcc
atgtcgcgcgtcggcatgggcgcctcgggcggcgcctggttcatggacccttcggtcggc
ctgcccggctggttcgtgccgcaaggcatctcggccgacctgatcgccaccaaatacggc
ttctcccgcgacgatgtcgacgcatacgcggtcgagagccagaagcgcgccgccaaatcc
tgggccgatggccgcttcaagaactccgtcatcccgatcaaggaccagaacggcctgacc
attctcgaccatgacgagcatatgcggccgtcgacggacatgcagtcgctggcctcgctc
aatccgtccttcgtcatgcccggcgaaatgggcggcttcgatgcggtcgcagtgcagaag
catcccgaggtggaagaggtcaaccacgtccaccatgccggcaattcgtcgggcatcgtc
gacggcgcggcggctgtgctgctcggttcgaagagggccgggaaaaccatggggctgaag
ccgcgcgcgcgcatccgcaccttcgccaacatcggctccgagccggtgctgatgctgaca
ggtccggtcgatgtcaccgagaagctgttgaagcgcgccaagatgaagctgtccgacatc
gacctgttcgaactcaacgaggcttttgcctcggtggtgctgcgctacatgcaggctttc
gacatcccgcacgacaagatcaacgtcaatggcggcgccatcgccatgggccatccgctc
ggtgccaccggcgcgatgatcctcggcacggtgctggacgaactcgagcgccgtgacctc
aacaccgcgctggtgaccttgtgcatcggcgccggcatgggcacggcaaccatcatcgaa
cgcgtctga

DBGET integrated database retrieval system