KEGG   Methylobacterium oryzae: MOC_0181Help
Entry
MOC_0181          CDS       T03299                                 

Definition
(GenBank) Aldehyde Dehydrogenase
  KO
K00128  aldehyde dehydrogenase (NAD+) [EC:1.2.1.3]
Organism
mor  Methylobacterium oryzae
Pathway
mor00010  Glycolysis / Gluconeogenesis
mor00053  Ascorbate and aldarate metabolism
mor00071  Fatty acid degradation
mor00280  Valine, leucine and isoleucine degradation
mor00310  Lysine degradation
mor00330  Arginine and proline metabolism
mor00340  Histidine metabolism
mor00380  Tryptophan metabolism
mor00410  beta-Alanine metabolism
mor00561  Glycerolipid metabolism
mor00620  Pyruvate metabolism
mor00625  Chloroalkane and chloroalkene degradation
mor00903  Limonene and pinene degradation
mor01100  Metabolic pathways
mor01110  Biosynthesis of secondary metabolites
mor01120  Microbial metabolism in diverse environments
mor01130  Biosynthesis of antibiotics
Module
mor_M00135  GABA biosynthesis, eukaryotes, putrescine => GABA
Brite
KEGG Orthology (KO) [BR:mor00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    MOC_0181
   00053 Ascorbate and aldarate metabolism
    MOC_0181
   00620 Pyruvate metabolism
    MOC_0181
  09103 Lipid metabolism
   00071 Fatty acid degradation
    MOC_0181
   00561 Glycerolipid metabolism
    MOC_0181
  09105 Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    MOC_0181
   00310 Lysine degradation
    MOC_0181
   00330 Arginine and proline metabolism
    MOC_0181
   00340 Histidine metabolism
    MOC_0181
   00380 Tryptophan metabolism
    MOC_0181
  09106 Metabolism of other amino acids
   00410 beta-Alanine metabolism
    MOC_0181
  09109 Metabolism of terpenoids and polyketides
   00903 Limonene and pinene degradation
    MOC_0181
  09111 Xenobiotics biodegradation and metabolism
   00625 Chloroalkane and chloroalkene degradation
    MOC_0181
Enzymes [BR:mor01000]
 1. Oxidoreductases
  1.2  Acting on the aldehyde or oxo group of donors
   1.2.1  With NAD+ or NADP+ as acceptor
    1.2.1.3  aldehyde dehydrogenase (NAD+)
     MOC_0181
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Aldedh Ntox10
Motif
Other DBs
NCBI-ProteinID: AIQ87936
UniProt: A0A089NJ95
Position
170135..171616
Genome map
AA seq 493 aa AA seqDB search
MKTYQLYIDGQFVDPVEGSWFESIDPYRGEPWARIPRAGRADVDRAVAAAKRAMWEGPWA
TMTATARGKVLRRIGDLVEREAKALAEVEVRDNGKLFAEMYGQTRYQPEWWWYYAGLADK
VEGAQVPIDKPETFAFTRHEPVGVVGALTAWNSPLLFVAWKCAPALAAGCAVVVKPSEFA
SASTLEFARLTKEAGLPDGMFNVITGFGGEAGSAIVEHPDVAKITFTGSDATGAKVYEAA
ARQIKRVSLELGGKSPNIVFADADLKAAAAGAISGIFAATGQTCIAGSRLLVQNSIRQEF
TDRLIELARTAKLGDPMQADTNIGPITTPPQYTKVLDYIALAKSEGARCVFGGNPASGPG
VLGGQFVEPTIFTGVTNDMRIAQEEVFGPVLSIIGFEDEAEALRLGNDVIYGLAAGVWTQ
DIGRAMRMSKGLRAGTVWVNTYRAVSYMMPFGGMKRSGIGRESGIESIREFLETKSVWIS
TSRDAPENPFVMR
NT seq 1482 nt NT seq  +upstreamnt  +downstreamnt
gtgaagacctaccagctctacatcgacgggcaattcgtcgatccggtcgagggctcgtgg
ttcgagtccatcgatccctatcgcggtgagccctgggcccggatcccacgtgccgggcgg
gccgatgtcgaccgggcggtggccgccgccaagcgcgccatgtgggagggcccctgggcc
accatgacggccaccgcgcgcggcaaggtgctgcgccggatcggcgacctcgtggagcgc
gaagcgaaagctctcgccgaggtcgaggtccgcgacaacggcaagctgttcgccgagatg
tacggccagacccgctaccagccggaatggtggtggtactatgcggggcttgccgacaag
gtcgagggcgcccaggtgccgatcgacaagcccgagaccttcgcgttcacccggcacgag
ccggtgggcgtggtcggggcgctgacggcgtggaactcgccgctcttgttcgtggcctgg
aaatgtgcgcccgcgctcgcggccggctgcgcggtcgtggtgaagccctccgagttcgcc
tcagccagcacgctggaattcgcccggctcaccaaggaggcggggctgcccgacgggatg
ttcaacgtcatcaccggcttcggcggcgaggccggcagcgcgatcgtcgagcatccggac
gttgccaagatcaccttcacgggctctgacgcgaccggcgcgaaggtctacgaagcggcc
gcgcgccagatcaagcgcgtctccctggaactcggcggcaagtcgcccaacatcgtcttc
gccgatgccgacctgaaggccgccgccgcgggcgcgatctcgggcatcttcgcggccacc
gggcagacctgcatcgccggctcgcgcctgctggttcagaacagcatccgccaggaattc
accgaccgactgatcgaactcgcccgcaccgccaagctcggcgacccgatgcaggcggac
accaatatcgggccgatcaccacgccgccgcaatacacgaaggtgctcgactacattgcg
ctggccaagagcgagggggcccgctgcgtcttcggcggcaatcccgcctccggtcccggc
gtgctcggcggccagttcgtggagccgacgattttcaccggcgtcaccaacgacatgcgt
atcgcccaggaggaggtgttcggcccggtcctgtcgatcatcggcttcgaggacgaggcc
gaggcgctccggctcggcaacgacgtgatctacgggctcgccgccggcgtttggacgcag
gatatcggccgcgcgatgcggatgtcgaaggggctgcgggccggcaccgtctgggtgaac
acctaccgggcggtgagctacatgatgccgttcggcggcatgaagcgctccggcatcggc
cgcgagagcggcatcgagtcgatccgcgagttcctggagaccaagagcgtctggatctcg
accagccgcgacgcgccggagaaccccttcgtcatgcggtga

DBGET integrated database retrieval system