KEGG   Methylobacterium oryzae: MOC_0294Help
Entry
MOC_0294          CDS       T03299                                 

Definition
(GenBank) S-(hydroxymethyl)glutathione dehydrogenase/class III alcohol dehydrogenase
  KO
K00121  S-(hydroxymethyl)glutathione dehydrogenase / alcohol dehydrogenase [EC:1.1.1.284 1.1.1.1]
Organism
mor  Methylobacterium oryzae
Pathway
mor00010  Glycolysis / Gluconeogenesis
mor00071  Fatty acid degradation
mor00350  Tyrosine metabolism
mor00625  Chloroalkane and chloroalkene degradation
mor00626  Naphthalene degradation
mor00680  Methane metabolism
mor01100  Metabolic pathways
mor01110  Biosynthesis of secondary metabolites
mor01120  Microbial metabolism in diverse environments
mor01200  Carbon metabolism
mor01220  Degradation of aromatic compounds
Brite
KEGG Orthology (KO) [BR:mor00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    MOC_0294
  09102 Energy metabolism
   00680 Methane metabolism
    MOC_0294
  09103 Lipid metabolism
   00071 Fatty acid degradation
    MOC_0294
  09105 Amino acid metabolism
   00350 Tyrosine metabolism
    MOC_0294
  09111 Xenobiotics biodegradation and metabolism
   00625 Chloroalkane and chloroalkene degradation
    MOC_0294
   00626 Naphthalene degradation
    MOC_0294
Enzymes [BR:mor01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.1  alcohol dehydrogenase
     MOC_0294
    1.1.1.284  S-(hydroxymethyl)glutathione dehydrogenase
     MOC_0294
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ADH_zinc_N ADH_N ADH_zinc_N_2 2-Hacid_dh_C AlaDh_PNT_C UDPG_MGDP_dh_N TrkA_N Met_10
Motif
Other DBs
NCBI-ProteinID: AIQ88049
UniProt: A0A089Q0A4
Position
complement(291362..292498)
Genome map
AA seq 378 aa AA seqDB search
MKTRAAVAWEAKKPLTIETIDIEGPKAGEVLVELMATGICHTDAYTLSGLDSEGKFPAIL
GHEGAGIVREVGAGVTTLKPGDHVIPLYTPECRNCKSCLSQRTNLCTAIRATQGQGVMPD
GTSRFSCVSTGGSPGGSSTVFHYMGCSTFSNFTVLPAIALAKIREDAPFDKICYIGCGVT
TGIGAVIYTAKVWPGANVVVFGLGGIGLNVLQAARMVGADKIIGVDINPEKQAMARKFGM
TDFINPNEVGTDKVVQAIVDLTGGGADFSFDCTGNVHVMRQALECCHRGWGESIVIGVAE
AGREISTRPFQLVTGRVWKGSAFGGARGRTDVPKIVDWYMEGKINIDDLITHTMPLEEIN
HGFDLMHEGKSIRSVVVY
NT seq 1137 nt NT seq  +upstreamnt  +downstreamnt
atgaagacgcgcgcggctgtcgcgtgggaggccaagaagcctctcacgatcgagaccatc
gacatcgaggggcccaaggccggcgaggttctcgtcgagctgatggccaccgggatctgc
cacaccgatgcctacacgctgtcgggcctggattccgagggcaagttcccggcgatcctc
ggccatgagggcgcgggcatcgtccgcgaggtcggcgccggcgtcaccacgctgaagccc
ggcgaccatgtcatcccgctctacacgccggaatgccgcaactgtaagtcctgcctgtcc
cagcgcaccaacctgtgcaccgcgatccgggcgacccagggccagggcgtgatgccggac
ggcacgagccgcttctcctgcgtctccaccggcggcagcccgggcggttcgagcaccgtg
ttccactacatgggctgctcgaccttctcgaacttcacggtcctgcccgccatcgcgctg
gccaagatccgcgaagacgcccccttcgacaagatctgctacatcggctgcggcgtgacc
accgggatcggagcagtgatctacaccgccaaggtctggccgggcgccaacgtggtggtg
ttcggtctcggcggcatcggcctcaacgtgctccaggccgcccggatggtcggtgccgac
aagatcatcggcgtcgacatcaacccggagaagcaggccatggcccgcaaattcggcatg
accgacttcatcaatccgaacgaggtcggaaccgacaaggtggttcaggccatcgtcgat
ctcaccggcggcggcgccgatttctccttcgactgcaccggcaacgtccacgtgatgcgc
caggccctcgagtgctgccatcgcggctggggcgagtcgatcgtcatcggcgtggcggaa
gccggccgcgagatctcgacccgtccgttccagctcgtcaccggccgcgtctggaagggt
tcggcgttcggcggcgcgcgcggacgcacggacgtgccgaagatcgtcgactggtacatg
gagggtaagatcaacatcgacgatctgatcacccacaccatgccgctggaggagatcaac
cacggcttcgacctcatgcacgagggcaagtcgatccgctccgtggtcgtctactaa

DBGET integrated database retrieval system