KEGG   Methylobacterium oryzae: MOC_1476Help
Entry
MOC_1476          CDS       T03299                                 

Definition
(GenBank) Amidase
  KO
K02433  aspartyl-tRNA(Asn)/glutamyl-tRNA(Gln) amidotransferase subunit A [EC:6.3.5.6 6.3.5.7]
Organism
mor  Methylobacterium oryzae
Pathway
mor00970  Aminoacyl-tRNA biosynthesis
mor01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:mor00001]
 09120 Genetic Information Processing
  09122 Translation
   00970 Aminoacyl-tRNA biosynthesis
    MOC_1476
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03029 Mitochondrial biogenesis [BR:mor03029]
    MOC_1476
Enzymes [BR:mor01000]
 6. Ligases
  6.3  Forming carbon-nitrogen bonds
   6.3.5  Carbon-nitrogen ligases with glutamine as amido-N-donor
    6.3.5.6  asparaginyl-tRNA synthase (glutamine-hydrolysing)
     MOC_1476
    6.3.5.7  glutaminyl-tRNA synthase (glutamine-hydrolysing)
     MOC_1476
Mitochondrial biogenesis [BR:mor03029]
 Mitochondrial DNA transcription, translation, and replication factors
  Mitochondrial transcription and translation factors
   Other mitochondrial DNA transcription and translation factors
    MOC_1476
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Amidase
Motif
Other DBs
NCBI-ProteinID: AIQ89231
UniProt: A0A089NMU3
Position
1478024..1479445
Genome map
AA seq 473 aa AA seqDB search
MMQTDATGPLWTLSATALGRRYAAGTASPVAAARACLDRAEAVNPGLNALVAVDPEGAAR
AAAASAARWAAGRPLGPLDGVPVTIKDSLNVAGFATGWGSRLYAGQGADRDETPVARLRA
AGAVILGKTNVPELTVQGYTGNPVSGVTRNPWDPALTPGGSSGGAVAAVAAGIGPLALGT
DAGGSIRRPASHTGLVGLKPTAGRVPRTGGLPPIMLDLEVVGPMARTVDDLAALMRILGA
ADPNAVAPNGFGSFGTAAMPERPLRILHVPAFGTAPVDPEIADSVAEAAGRLAGLGHRVE
TGRFDAATAITEAWPILGQAGIAWLMRAHPGRRDDLGPDIRALAEAGAALSAADLFDVQR
MALALRQDLAALFAAHDLLMTPTAAALPWRAEDTHPERIAGVPVGPRGSATFTGFVNAAG
CPGISIPCRPSRAGLPIGFQLVAPWGRDEALVAMAAAYEAAHPWRMLWEGGAP
NT seq 1422 nt NT seq  +upstreamnt  +downstreamnt
atgatgcagaccgatgcgacgggcccgctctggaccctctcggccaccgccctgggccga
cgctacgccgccgggacggcgagcccggtcgcggccgcccgcgcctgcctggaccgggcc
gaggccgtgaacccggggctcaacgccctggtcgccgtcgatcccgaaggtgcggcgcgc
gccgccgcggcgagtgcggcccgctgggcggcgggccggccgctcggccccctcgacggc
gtgccggtgaccatcaaggacagcctgaacgtcgccgggttcgccaccggctggggcagc
cggctctacgcggggcagggggcggaccgggacgagacgccggtggcccgcctgcgcgcg
gccggagcggtgatcctgggcaagaccaacgtcccggaactgaccgtccagggctatacc
gggaacccggtctccggcgtcacccgcaacccctgggatccggcgctgaccccggggggc
tccagcggcggcgccgtcgcggcggtggccgccgggatcggccccctggccctcgggacc
gatgcgggcggctcgatccgccgccccgcctcccataccggcctcgtcggcctgaaaccc
accgccggacgggtgccgcgaaccggcgggctgccgccgatcatgctcgacctcgaggtg
gtcgggccgatggcgcgcacggtcgacgacctcgcggcgctgatgcggatcctcggggcg
gccgatccgaacgcggtcgcgccgaacggcttcggctcgttcgggaccgccgcaatgccg
gagcgcccgctgcggatcctccatgtcccggcctttggcaccgccccggtcgatcccgag
atcgccgacagcgtcgccgaggcggccgggcgcctcgccggcctcggccaccgggtcgag
accggccgcttcgacgcggcgaccgccatcacggaggcgtggccaatcctcggccaggcc
ggaatcgcctggctgatgcgggcgcatccgggccggcgcgacgacctcggccccgacatc
cgcgccctagcggaggccggggcggccctctcggcggccgacctgttcgacgtgcagcgg
atggcgctggcgctgcgccaggatctcgccgccctgttcgccgcgcatgatctgctgatg
acgcccacggcggcagcgctgccctggcgggcggaggacacccatccggagcgcatcgcc
ggggtgccggtggggccccgcggctcggcgaccttcacgggcttcgtcaacgccgccggc
tgtcccgggatctcgatcccctgccgcccctcccgtgccgggctgccgatcgggttccag
ctcgtggcgccctggggccgcgacgaggctctggtggcgatggcggcggcctacgaggcc
gcccatccctggcggatgctctgggagggcggcgccccgtga

DBGET integrated database retrieval system