KEGG   Methylobacterium oryzae: MOC_1611Help
Entry
MOC_1611          CDS       T03299                                 

Definition
(GenBank) Acetyl-CoA acetyltransferase
  KO
K00626  acetyl-CoA C-acetyltransferase [EC:2.3.1.9]
Organism
mor  Methylobacterium oryzae
Pathway
mor00071  Fatty acid degradation
mor00072  Synthesis and degradation of ketone bodies
mor00280  Valine, leucine and isoleucine degradation
mor00310  Lysine degradation
mor00362  Benzoate degradation
mor00380  Tryptophan metabolism
mor00620  Pyruvate metabolism
mor00630  Glyoxylate and dicarboxylate metabolism
mor00640  Propanoate metabolism
mor00650  Butanoate metabolism
mor00900  Terpenoid backbone biosynthesis
mor01100  Metabolic pathways
mor01110  Biosynthesis of secondary metabolites
mor01120  Microbial metabolism in diverse environments
mor01130  Biosynthesis of antibiotics
mor01200  Carbon metabolism
mor01212  Fatty acid metabolism
mor02020  Two-component system
Brite
KEGG Orthology (KO) [BR:mor00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00620 Pyruvate metabolism
    MOC_1611
   00630 Glyoxylate and dicarboxylate metabolism
    MOC_1611
   00640 Propanoate metabolism
    MOC_1611
   00650 Butanoate metabolism
    MOC_1611
  09103 Lipid metabolism
   00071 Fatty acid degradation
    MOC_1611
   00072 Synthesis and degradation of ketone bodies
    MOC_1611
  09105 Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    MOC_1611
   00310 Lysine degradation
    MOC_1611
   00380 Tryptophan metabolism
    MOC_1611
  09109 Metabolism of terpenoids and polyketides
   00900 Terpenoid backbone biosynthesis
    MOC_1611
  09111 Xenobiotics biodegradation and metabolism
   00362 Benzoate degradation
    MOC_1611
 09130 Environmental Information Processing
  09132 Signal transduction
   02020 Two-component system
    MOC_1611
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:mor04147]
    MOC_1611
Enzymes [BR:mor01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.9  acetyl-CoA C-acetyltransferase
     MOC_1611
Exosome [BR:mor04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   MOC_1611
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Thiolase_N Thiolase_C ketoacyl-synt
Motif
Other DBs
NCBI-ProteinID: AIQ89366
UniProt: A0A089NNA6
Position
complement(1634261..1635439)
Genome map
AA seq 392 aa AA seqDB search
MRDIVLCHPVRTAIGAYGGSLKGVAATDLGATAIRETLRRAGLEAGKLGGVTMGNVVQAG
NRMNPARQAAVNGGVPVSVPALTVNRVCGSGAQAIATAADEIRLGHHDVAVAGGMENMDR
APYLMEGGRWGYRMGHAQILDSMLNDGLNDAFSGEHSGWHTEDLAARSQIGREAQDAWAA
RSQARFAKAQTTGAFDAEVAAVEVKGRKGPETFARDEAPRPETTAETLAKLKPAFRKDGT
ITAGNAPGLNSGAAAMIVAERGFAEANGLDAYGRLVAYGVGACEPGLFGLGPVPAVRQAL
ERAGWSLGDLGRVEINEAFAVVPLAVAKELGLPDDIVNVEGGAIAHGHPIGATGAVLTTR
LLHSMRRDGIRRGLVTLCIGGGQGIALLLEAN
NT seq 1179 nt NT seq  +upstreamnt  +downstreamnt
atgcgtgacatcgttctttgccatcccgtccgcaccgcaatcggcgcctatggcggtagc
ctgaagggtgtggccgcgaccgacctcggcgcgaccgcgatccgggagaccctgaggcgg
gccggcctggaggccggcaagctcggcggcgtgacgatgggcaacgtcgtccaggccggc
aaccgcatgaatcccgcccggcaggcggccgtgaacggcggcgtgcccgtctcggtgcct
gcactcacggtcaaccgggtctgcggctcgggcgcgcaggccatcgccacggcggccgac
gagatccggctcgggcaccacgacgtggcggtcgccggcggcatggagaacatggaccgc
gccccgtacctgatggagggtggccgctgggggtaccgcatgggccatgcccagatcctc
gacagcatgctgaacgacggcctcaacgacgcgttctccggcgagcattccggttggcac
accgaggacctcgccgcgcggtcccagatcggtcgggaggcgcaagatgcctgggcggcc
cgctcgcaggcgcggttcgccaaggcgcagaccaccggcgcgttcgacgccgaggtcgcc
gccgtcgaggtcaagggccggaagggaccggagacgttcgctcgcgacgaggcgccccgg
ccggagacgacggccgagaccttggccaagctgaagcccgccttccggaaggacgggacc
atcactgccggtaacgcacccggcctgaactccggcgcggctgcgatgatcgtggccgaa
cgcgggttcgccgaggccaacggcctcgacgcctacgggcggctggtcgcctacggcgtg
ggggcctgcgagcccggcctgttcggcctcgggcccgtccccgccgtccggcaggcgcta
gaacgggccggttggagcctcggggatctcgggcgggtcgagatcaacgaggccttcgcc
gtcgttcccctcgccgtcgcgaaggagctgggcctgccggatgacatcgtcaatgtcgag
ggtggtgcaatcgcccacggccatcccatcggggcgaccggtgcggtcctgacgacccgc
ctcctgcattccatgaggcgggacggcatccggcgcggtctcgtcaccctctgcatcggt
ggcggccagggcatcgcactgctgctggaagcgaactga

DBGET integrated database retrieval system