KEGG   Methylobacterium oryzae: MOC_2252Help
Entry
MOC_2252          CDS       T03299                                 

Gene name
bchN
Definition
(GenBank) light-independent protochlorophyllide reductase, subunit N
  KO
K04038  light-independent protochlorophyllide reductase subunit N [EC:1.3.7.7]
Organism
mor  Methylobacterium oryzae
Pathway
mor00860  Porphyrin and chlorophyll metabolism
mor01100  Metabolic pathways
mor01110  Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:mor00001]
 09100 Metabolism
  09108 Metabolism of cofactors and vitamins
   00860 Porphyrin and chlorophyll metabolism
    MOC_2252 (bchN)
Enzymes [BR:mor01000]
 1. Oxidoreductases
  1.3  Acting on the CH-CH group of donors
   1.3.7  With an iron-sulfur protein as acceptor
    1.3.7.7  ferredoxin:protochlorophyllide reductase (ATP-dependent)
     MOC_2252 (bchN)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Oxidored_nitro E3_binding
Motif
Other DBs
NCBI-ProteinID: AIQ90007
UniProt: A0A089NRJ2
Position
complement(2299190..2300464)
Genome map
AA seq 424 aa AA seqDB search
MNAPLIHQPPCGGIDLHQEQGQRAVFCGLTGIVWLHRKIQDAFFLVVGSRTCAHLIQSAA
GVMIFAEPRFATAIIDERDLAGIADANEELDRVVTRLIERRPDIKLLFLVGSCPSEVIKL
DLSRAAQRLSGRLAPVRVLNYSGSGIETTFTQGEDACLAALVPDLPREVETAAPSLLVVG
ALADVVEDQFLRIFAAMGIGDVRFLPARRADTMPSVGRNTRYLLAQPFLADTARALEERG
ARRLPAPFPLGAEGTTGWLRAAAEAFGVAEAVFDRATAPGRTRAETALAPHREKLAGKRV
FFFPDSQLEVPLARFLARELGADLVEVGTPYLHRAHLAAEIELLPQGTRVTEGQSLDDQM
DRCRAARPDLTVCGLGLANPLEAEGLSTKWSIELLFTPVQGYEQAGDLAELFVRPLRRRA
LLEV
NT seq 1275 nt NT seq  +upstreamnt  +downstreamnt
atgaacgctcccctgatccaccagcctccctgcggcggcatcgacctgcaccaagagcag
gggcagagggcggtgttctgcggcctcaccggcatcgtctggctccaccggaagatccag
gacgccttcttcctcgtggtcggctcacggacctgcgcgcatctgattcagtccgccgcc
ggggtgatgatcttcgccgagccgcgcttcgcgaccgcgatcatcgacgagcgcgacctc
gccgggatcgccgacgcgaacgaggaactcgaccgggtcgtgacccggttgatcgagcgg
cggccggatatcaagctcctgttcctggtgggctcctgcccgtcggaggtgatcaagctc
gacctgtcccgggcggcgcaacggctgtcggggcgcctcgcccccgtgcgggtcctgaac
tactccggctccggcatcgagacgacgttcacgcagggcgaggatgcctgcctcgccgcc
ctggtgccggacctgccccgcgaggtcgagacggccgcgccgtcgctcctggtcgtcggg
gcgctggccgacgtggtggaggaccagtttcttcggatttttgccgcgatggggatcggc
gacgtccggttcctgcccgcccgccgggccgacacgatgccctcggtcgggcgcaacacg
cgctacctcctggcccaaccgttcctggccgacacggcccgcgccctcgaagagcgcggc
gcccgccggctcccggcgccgttcccgctcggtgccgagggcacgaccggatggctgcgg
gcggcggctgaggcgttcggcgtcgccgaggccgtcttcgaccgggcgacggccccgggc
cgcacccgtgccgagaccgccctcgcgccccatcgcgaaaagctcgcgggcaagcgcgtg
ttcttcttccctgattcgcagctcgaagtgccgctcgcccgcttcctcgcccgggaactc
ggcgcggatctcgtggaggtcgggacgccttacctgcaccgggcgcatctcgccgccgag
atcgagctgctgccccagggtacgcgggtgaccgagggccagagcctcgacgaccagatg
gaccgctgccgagcggcgcgcccggacctcacggtctgcggcctcggcctcgccaacccg
ctggaggcggagggcctgtcgaccaagtggtcgatcgagctgctgttcacgccggtacag
ggctacgagcaggccggcgacctcgccgagctgttcgtgcgcccgctccggcgccgcgcc
ctgctggaggtgtag

DBGET integrated database retrieval system