KEGG   Moraxella osloensis: AXE82_04780Help
Entry
AXE82_04780       CDS       T04294                                 

Definition
(GenBank) acetyl-CoA acetyltransferase
  KO
K00626  acetyl-CoA C-acetyltransferase [EC:2.3.1.9]
Organism
mos  Moraxella osloensis
Pathway
mos00071  Fatty acid degradation
mos00072  Synthesis and degradation of ketone bodies
mos00280  Valine, leucine and isoleucine degradation
mos00310  Lysine degradation
mos00362  Benzoate degradation
mos00380  Tryptophan metabolism
mos00620  Pyruvate metabolism
mos00630  Glyoxylate and dicarboxylate metabolism
mos00640  Propanoate metabolism
mos00650  Butanoate metabolism
mos00900  Terpenoid backbone biosynthesis
mos01100  Metabolic pathways
mos01110  Biosynthesis of secondary metabolites
mos01120  Microbial metabolism in diverse environments
mos01130  Biosynthesis of antibiotics
mos01200  Carbon metabolism
mos01212  Fatty acid metabolism
mos02020  Two-component system
Brite
KEGG Orthology (KO) [BR:mos00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00620 Pyruvate metabolism
    AXE82_04780
   00630 Glyoxylate and dicarboxylate metabolism
    AXE82_04780
   00640 Propanoate metabolism
    AXE82_04780
   00650 Butanoate metabolism
    AXE82_04780
  09103 Lipid metabolism
   00071 Fatty acid degradation
    AXE82_04780
   00072 Synthesis and degradation of ketone bodies
    AXE82_04780
  09105 Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    AXE82_04780
   00310 Lysine degradation
    AXE82_04780
   00380 Tryptophan metabolism
    AXE82_04780
  09109 Metabolism of terpenoids and polyketides
   00900 Terpenoid backbone biosynthesis
    AXE82_04780
  09111 Xenobiotics biodegradation and metabolism
   00362 Benzoate degradation
    AXE82_04780
 09130 Environmental Information Processing
  09132 Signal transduction
   02020 Two-component system
    AXE82_04780
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:mos04147]
    AXE82_04780
Enzymes [BR:mos01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.9  acetyl-CoA C-acetyltransferase
     AXE82_04780
Exosome [BR:mos04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   AXE82_04780
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Thiolase_N Thiolase_C ketoacyl-synt ACP_syn_III_C
Motif
Other DBs
NCBI-ProteinID: AME01163
UniProt: A0A0X8K5W7
Position
1077026..1078234
Genome map
AA seq 402 aa AA seqDB search
MSNTAYIYDAIRTPRGKGKSDGSLHQVAPIWLIRELLTNLQSRNQLDTQLVDDVVLGCVT
PVGEQGSDIARIAVIDAGWAESVAGVTLSRFCASGLESINLAASKIMSGMEDMVVAGGVE
SMSRVKMGLDGGAWYMDPRVNTATGFAPQGIGADTIATLEGFSRSDVDAYATESHRRAQQ
ASDQGYFAKSIIPVKDINGLMILDHDETIRADTSVERLAELKPSFAMPGKMGFDKVVLDK
YATIEKINHVHHAGNSSGIVDGAALCLLGSQSAGQAANLKPRAKVTMAAVVGSEPTIMLT
GPTLAARKALARANMQVSDIDLWEINEAFAAVPMKTAKDLGLNMDIVNVNGGAIAMGHPL
GATGAILINTLLDELERRDLTTGLATLCVGGGMGIATIIERV
NT seq 1209 nt NT seq  +upstreamnt  +downstreamnt
atgagtaataccgcttatatttatgatgctatccgcaccccgcgtggcaaaggcaaatcc
gatggcagcttgcaccaagtcgctccaatttggttaatcagagaactactgacaaattta
cagtcgcgcaatcagttggacacacagttggtggatgatgtggtactaggttgtgtcacc
cctgttggtgagcaaggctcggatatcgcccgaattgcggtaattgatgccggttgggca
gaatcggtggcgggcgttaccctatcacggttttgtgcatcagggttagagtcgattaat
ttagccgcaagcaaaatcatgtcgggcatggaagatatggtggtggcaggtggcgtggag
tctatgagccgtgtcaaaatggggttagacggcggggcttggtacatggacccacgtgtc
aataccgccaccggctttgccccacaaggcatcggcgctgatacgattgcgacattagaa
gggtttagtcgcagtgatgttgatgcatatgccaccgagtctcatcgcagagcccagcag
gcttctgaccaagggtattttgctaaatcaattattcctgttaaagatatcaatggtctg
atgattttagaccatgatgaaaccattcgcgctgataccagcgttgaacgcttggcagaa
ttaaagccctcgtttgccatgccaggaaaaatgggctttgataaagtggtcttagataaa
tatgccacgattgaaaaaattaaccatgtgcaccatgccggtaactcatcaggtatcgtt
gacggggccgcgttatgtctgcttggtagtcaatcagcgggacaagcggcgaatttaaaa
ccccgtgccaaagtcacgatggcggcagtggtggggtcagaaccgacgataatgctaaca
ggtccgacactggccgcaagaaaagccttagcccgggcgaatatgcaggtgtctgatatt
gacctatgggaaattaacgaagcgtttgcagcggtgccaatgaaaacggcaaaagaccta
gggcttaatatggatatcgtgaatgtcaacggtggtgcgattgctatgggacatccatta
ggggcaacaggagcaattttaattaacaccttgttagatgaattggagcgtcgtgatttg
accactggacttgcgaccttatgtgtcggtggcggtatgggtattgccacgattattgaa
cgtgtttaa

DBGET integrated database retrieval system