KEGG   Moraxella osloensis: AXE82_05080Help
Entry
AXE82_05080       CDS       T04294                                 

Definition
(GenBank) farnesyl-diphosphate synthase
  KO
K00795  farnesyl diphosphate synthase [EC:2.5.1.1 2.5.1.10]
Organism
mos  Moraxella osloensis
Pathway
mos00900  Terpenoid backbone biosynthesis
mos01100  Metabolic pathways
mos01110  Biosynthesis of secondary metabolites
mos01130  Biosynthesis of antibiotics
Brite
KEGG Orthology (KO) [BR:mos00001]
 09100 Metabolism
  09109 Metabolism of terpenoids and polyketides
   00900 Terpenoid backbone biosynthesis
    AXE82_05080
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01006 Prenyltransferases [BR:mos01006]
    AXE82_05080
Enzymes [BR:mos01000]
 2. Transferases
  2.5  Transferring alkyl or aryl groups, other than methyl groups
   2.5.1  Transferring alkyl or aryl groups, other than methyl groups (only sub-subclass identified to date)
    2.5.1.1  dimethylallyltranstransferase
     AXE82_05080
    2.5.1.10  (2E,6E)-farnesyl diphosphate synthase
     AXE82_05080
Prenyltransferases [BR:mos01006]
 Terpene biosynthesis
  Prenyl diphosphate synthase
   AXE82_05080
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: polyprenyl_synt
Motif
Other DBs
NCBI-ProteinID: AME02291
UniProt: A0A378Q7A9
Position
1170625..1171530
Genome map
AA seq 301 aa AA seqDB search
MEFTAFSRQVIDQLESDITAYLQACKLPSPLHEASLYAMTNGGKRVRPLLIAATFATVKT
ESSLTHPSHQLSNDVRRAMMAVECLHGYSLVHDDLPCMDDDALRRGRPTTHIAYGEAAAM
LAGDVLQTLAFEALTHTYFGENSEFATPLSATFAPRARRMVMGQMLDLNGEHQQLSQTEL
EAIHRDKTGALIEASVLMGAICANATDSERQALNSFAEQIGLAFQVQDDILDVTADTKQL
GKPAGSDEKLDKSTYVKLLGVEAAKDYAQSLFDTAKNTIVAEFGMENYLVDLADWLWERE
K
NT seq 906 nt NT seq  +upstreamnt  +downstreamnt
atggaatttactgctttttcgcgccaagtcattgaccaattagaatcggatatcacagcc
tacctccaagcctgtaagttaccctcgccgctgcatgaagcaagcctatacgcgatgacc
aatggcggcaaacgggtacgtcctttactgattgcagcaacttttgccacagtaaaaacc
gaaagcagtcttacccacccatcccatcaattatctaatgacgtgcgccgtgccatgatg
gcggtagagtgtctacacggctattcgctggtgcatgatgacttgccttgtatggatgat
gatgcgctgcgccgagggcgccctaccacccatatcgcctatggtgaagccgctgcgatg
cttgccggtgacgtgctacagaccttagcatttgaagccctaacccatacgtattttggt
gaaaacagtgagtttgctaccccgctttctgccacgtttgcgccacgggcacggcggatg
gtgatggggcaaatgctggatttaaatggcgaacaccaacagcttagccaaactgagctt
gaggccatccaccgtgacaaaacaggcgcgctcattgaagcgtcagtattgatgggtgcc
atctgtgccaacgcgactgacagcgaacgccaagcactcaatagctttgccgagcagatt
ggcttggctttccaagtacaagatgatattttggatgtgactgctgacaccaaacagctt
ggcaaacctgcgggtagtgatgaaaaattggataaatccacttatgtcaaattactgggc
gtggaagctgctaaagactatgcccaaagcttgtttgatacggcaaaaaataccatcgtt
gctgaatttggcatggaaaactatctcgttgatttggcggattggttatgggaaagagag
aaatga

DBGET integrated database retrieval system