KEGG   Moraxella osloensis: AXE82_07415Help
Entry
AXE82_07415       CDS       T04294                                 

Definition
(GenBank) coproporphyrinogen III oxidase
  KO
K02495  oxygen-independent coproporphyrinogen III oxidase [EC:1.3.98.3]
Organism
mos  Moraxella osloensis
Pathway
mos00860  Porphyrin and chlorophyll metabolism
mos01100  Metabolic pathways
mos01110  Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:mos00001]
 09100 Metabolism
  09108 Metabolism of cofactors and vitamins
   00860 Porphyrin and chlorophyll metabolism
    AXE82_07415
Enzymes [BR:mos01000]
 1. Oxidoreductases
  1.3  Acting on the CH-CH group of donors
   1.3.98  With other, known, physiological acceptors
    1.3.98.3  coproporphyrinogen dehydrogenase
     AXE82_07415
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Radical_SAM HemN_C
Motif
Other DBs
NCBI-ProteinID: AME01607
UniProt: A0A378QCJ1
Position
1685209..1686687
Genome map
AA seq 492 aa AA seqDB search
MTDQTRPLSDSELPTFDRPVEIIENPYANANRNYTTQTHLFNEAIINKYNRSGPRYTSYP
TALEFVPIADGMEARVLAEKDPRVPVSLYFHIPFCRHLCYYCGCNKIITKKNSDSGDYLE
YLFSEIRHKRSLMQGDPIVEQVHFGGGTPTFLTDDELVKLWNFLQTQFTFSDKPTADYSI
EIDPRELRPTTLEILRGLGFNRVSFGVQDLQEKVQIAVNRVQSEEMIQGVMTEARRLGFH
SINIDLIYGLPHQTVDSMRNTVERIIDISPDRLSVFNYAHLPERFKGQRQINEADLPSPA
DKLTMLGNTIHALTDAGYQYIGIDHFAKPDDELAIAQREGKLHRNFQGYTTHGNCDLLGF
GVSSISQIGLHILQNPTDLNDYQNLINAGKLPAVKVISARLPDLLRRYVIMNLLCHDYID
FKDVNARFSIDPMTYFIDEIRQLGEMQADKLVDMDAKGIRVLPKGRLLGRNVAMVFDTYL
ASKEGNRFSKVI
NT seq 1479 nt NT seq  +upstreamnt  +downstreamnt
atgacagaccaaactcgccctttatctgacagcgaactgcccacttttgaccgccctgtc
gaaatcatcgaaaatccgtatgccaatgccaatcgtaactacaccacccaaacccatttg
tttaatgaagctatcatcaataaatacaaccgctcaggtccccgttatacctcgtaccca
accgcgctagaatttgtcccgattgctgacggtatggaagcccgcgttttggcagaaaaa
gacccacgggtgccagtgtccttgtattttcacattccgttttgtcgccacctgtgctat
tactgcggctgcaataaaatcatcaccaagaaaaacagtgattcaggcgattatcttgag
tacttattttcagaaattcggcataaacgcagcttgatgcaaggcgaccctatcgtcgaa
caagtgcattttggcggcggcacacccacctttttgaccgatgatgaactggtcaaattg
tggaactttttgcaaacccaatttacttttagcgataaacctaccgctgattattcgatt
gaaattgacccacgagaattgcgcccgaccacgcttgagatattgcgtggacttgggttt
aatcgggtgagttttggtgtgcaggatttgcaagaaaaagtacaaattgccgtcaatcgc
gtgcagtcagaagaaatgattcaaggggtgatgacggaagctcgccgccttgggtttcat
tctatcaatattgacttgatttacgggttgccgcaccaaacggtggatagcatgcgcaat
acggttgagcgcatcatcgatatatcgccagaccgtctatctgtttttaactatgcccat
ttgcccgagcgatttaaaggtcagcgtcagattaatgaagcggatttgccaagccctgcc
gacaaattgaccatgctcggtaataccatccatgcgctgactgacgcaggctatcaatat
atcggcattgaccactttgccaagcctgatgatgagctggcgattgcccaacgtgagggc
aaattgcaccgcaattttcaaggctataccacacatggcaattgtgatttactgggattt
ggggtgtcgtcaattagccagattggtcttcatattttgcaaaatccaacggatttgaat
gattaccaaaatctcatcaatgcgggaaaattgcctgcagtgaaggtgatttctgcgcgc
ttacctgacttgctgcgccgttatgtgattatgaatctgctatgccatgattatattgat
tttaaggatgtgaatgcgcgctttagtattgacccgatgacctattttattgatgaaatc
cgccaactgggcgagatgcaagcggataaactcgttgatatggatgccaaaggcattcgg
gtgctaccaaaagggcgacttttgggacgcaatgtagcgatggtgtttgatacttatttg
gcgagtaaagaaggcaatcgttttagtaaggtgatttaa

DBGET integrated database retrieval system