KEGG   Mycoplasma ovis: OVS_02630Help
Entry
OVS_02630         CDS       T02962                                 

Definition
(GenBank) 50S ribosomal protein L22
  KO
K02890  large subunit ribosomal protein L22
Organism
mov  Mycoplasma ovis
Pathway
mov03010  Ribosome
Brite
KEGG Orthology (KO) [BR:mov00001]
 09120 Genetic Information Processing
  09122 Translation
   03010 Ribosome
    OVS_02630
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03011 Ribosome [BR:mov03011]
    OVS_02630
Ribosome [BR:mov03011]
 Ribosomal proteins
  Mitochondria/ Chloroplast
   Large subunit
    OVS_02630
  Bacteria
    OVS_02630
  Archaea
    OVS_02630
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Ribosomal_L22 DUF2303
Motif
Other DBs
NCBI-ProteinID: AHC39978
UniProt: V9R9N3
Position
complement(427436..427900)
Genome map
AA seq 154 aa AA seqDB search
MKQQVRVKHRNLRISPTKAVHVCRLIHKKPLSTAYKILHSIDKKKIVKMLFKLLLEASAN
AVNNFAMSGDNLRVEECTATKGTRLKRGFYRAKGRTDLRTHRLTNLSVTLVEEAKAKDSK
KLKTPSTKSKIQEGAELSTKKIEEYIKEEEKAGI
NT seq 465 nt NT seq  +upstreamnt  +downstreamnt
atgaaacaacaagttagagtaaaacatcgaaatcttagaatttctccaaccaaagcagta
catgtttgtagattaattcacaagaagcctttatcaacagcttataagatacttcattct
attgataagaaaaagattgtaaaaatgctttttaaattattattagaggcttctgcaaac
gcagttaataattttgctatgagcggagacaatttaagagttgaggagtgtactgccaca
aagggcactagattaaagagaggtttttacagagcaaagggaagaacagatctaagaaca
cataggttaactaatctttcagtaactttagttgaagaggcgaaggcaaaagattcaaaa
aagttgaaaacgccttcaactaaatccaagattcaagagggagcagagctaagtactaaa
aaaatagaggagtacattaaggaggaagaaaaagctggtatttag

DBGET integrated database retrieval system