KEGG   Candidatus Methylomirabilis oxyfera: DAMO_0185Help
Entry
DAMO_0185         CDS       T02155                                 

Gene name
acsA
Definition
(GenBank) Acetyl-coenzyme A synthetase (Acetate--CoA ligase) (Acyl-activating enzyme)
  KO
K01895  acetyl-CoA synthetase [EC:6.2.1.1]
Organism
mox  Candidatus Methylomirabilis oxyfera
Pathway
mox00010  Glycolysis / Gluconeogenesis
mox00620  Pyruvate metabolism
mox00640  Propanoate metabolism
mox00680  Methane metabolism
mox01100  Metabolic pathways
mox01110  Biosynthesis of secondary metabolites
mox01120  Microbial metabolism in diverse environments
mox01130  Biosynthesis of antibiotics
mox01200  Carbon metabolism
Brite
KEGG Orthology (KO) [BR:mox00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    DAMO_0185 (acsA)
   00620 Pyruvate metabolism
    DAMO_0185 (acsA)
   00640 Propanoate metabolism
    DAMO_0185 (acsA)
  Energy metabolism
   00680 Methane metabolism
    DAMO_0185 (acsA)
Enzymes [BR:mox01000]
 6. Ligases
  6.2  Forming carbon-sulfur bonds
   6.2.1  Acid-thiol ligases
    6.2.1.1  acetate---CoA ligase
     DAMO_0185 (acsA)
Lipid biosynthesis proteins [BR:mox01004]
 Acyl-CoA synthetase
  Short/medium chain acyl-CoA synthetase
   DAMO_0185 (acsA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: AMP-binding AMP-binding_C ACAS_N
Motif
Other DBs
NCBI-ProteinID: CBE67292
UniProt: D5MIE2
Position
162960..164909
Genome map
AA seq 649 aa AA seqDB search
MTQTRSRDDTPISAPLRERRKFKPPATFVKRAVVNKASVYRAASKDPTAFWERQAKALHW
FKPWKRVLQWKAPHAKWFAGGKLNVAYNCLDRHVNGPLRTKAALIWEGEPGETRTFTYWD
LYREVNRFAAALKRHGVKKGDRITIYMPMIPEVAIAMLACARIGAPHSVIFGGFSPEAVR
DRILDADSALVITADGGYRRGGVVSLKQNTDEALKACPGVKTVIVVKRTGQVVEMQPGRD
VWWTDFIKDAPARCAPAIMDAEDMLFLLYTSGSTGKPKGIIHTTGGYLTGVVATHNWVFD
IQDNDVYWCTADVGWVTGHSYVVYGPLANGATTVMYEGTPDYPDKDRFWRIIERHGITIC
YTAPTAIRTFMKWGEEYPKRCDLSSLRLLGSVGEPINPEAWVWYWKVIGGGRCPVVDTWW
QTETGHILITPLPGITTLKPGSAAQPFPGIDAEVVDESGRPAATGYLVIRQPWPGMLRGI
WGDPDRYVKQYWSNYKGIYFTGDGASRDNDGDFWLLGRVDDVMNVSGHRVSTVEVESALV
DHPCVAEAAVIGRTHEIKGQAVAAFVTIRDGTRPTPELETAIKAHVVKKIGAFARPDDLI
FTAELPKTRSGKIMRRLLRDIAEGRALGDTTTLADANVVAELKAKYGEQ
NT seq 1950 nt NT seq  +upstreamnt  +downstreamnt
atgacccagactaggagtcgagacgataccccaatttcagcgcctctcagggagcgacga
aaattcaagccgcccgcgacgtttgtcaagcgggcggttgtcaataaggcttccgtttac
cgggcggcatcgaaagatccgactgcattctgggagcgccaggctaaggctcttcactgg
ttcaagccatggaagcgggtgctgcaatggaaagcaccgcatgccaagtggtttgccggc
ggcaagctgaacgtggcctataactgcctcgaccgccatgtgaacggtcccttgcgcacc
aaggcggccctcatctgggagggggaaccgggcgagacgcggacattcacctactgggac
ctctatcgtgaggtcaaccgctttgcggcggccctcaagcggcacggcgtcaaaaaagga
gatcggatcaccatctatatgccgatgatcccggaggtcgctattgcgatgctggcgtgt
gcgcgcatcggtgcgccccacagcgtgatcttcggcgggttctcgccggaggcggtccgg
gatcggatcctcgacgccgactcggctctcgtgattacggctgacggcggctaccgtcgt
ggcggggtggtctcgctcaaacagaacaccgacgaagcgcttaaggcgtgccccggcgtg
aaaaccgtcattgtagtcaagcggaccgggcaggtggtagagatgcagccgggccgggac
gtctggtggaccgatttcatcaaggacgcgccggccaggtgcgcccccgcgatcatggac
gccgaggatatgctgtttctcctctatacctccggttcgaccgggaaaccgaaagggatc
attcatactacaggcggctatctgaccggagtggtggccacacacaactgggtcttcgat
atccaagacaacgatgtctactggtgtaccgccgacgtgggctgggtcacgggtcattcc
tacgtcgtctatggaccgctggccaacggggccaccaccgtcatgtacgaggggaccccg
gattacccggataaggatcgcttttggcgcatcatcgagaggcatggaattacgatctgc
tatacggcccccacggccatccgcacctttatgaagtggggcgaggagtatccaaaacgc
tgcgacctctccagcctccggttgctcggcagcgttggtgaaccgatcaatcccgaggcg
tgggtctggtactggaaggtgatcggcggcggccgctgtccggtggtggacacctggtgg
cagaccgagaccggccatatcctcatcacgccgcttccaggaattacgacgctcaagccg
ggctcggctgcccaaccctttccggggatcgatgcggaggtggtggatgagagcggcagg
cccgctgcgaccggctatctcgtgattcgtcagccttggcccggtatgcttcgcgggatc
tggggcgaccctgaccgctatgtgaagcagtactggtcgaattataaaggcatctacttc
accggtgatggggccagccgggacaacgatggcgatttctggctgctggggcgcgtcgat
gacgtgatgaacgtctccggacatcgtgtctcgacggtggaggtggagtcggcccttgtg
gatcacccgtgcgtggccgaggcggctgtcatcgggcgcacacacgagattaaggggcag
gccgttgccgcctttgtgaccatccgggacggcaccaggccgacgccggagctcgagacg
gcgatcaaagctcatgtggtcaagaagatcggcgccttcgccaggccggacgacctgatc
tttacggccgaactgcccaaaacccgcagcggcaagatcatgcgccgcctgcttcgcgac
attgccgaaggccgggcattgggcgataccactacactggcggacgccaatgtagtggcc
gagctcaaggccaaatacggcgagcagtag

DBGET integrated database retrieval system