KEGG   Candidatus Methylomirabilis oxyfera: DAMO_0484Help
Entry
DAMO_0484         CDS       T02155                                 

Gene name
glk
Definition
(GenBank) Glucokinase (Glucose kinase)
  KO
K00845  glucokinase [EC:2.7.1.2]
Organism
mox  Candidatus Methylomirabilis oxyfera
Pathway
mox00010  Glycolysis / Gluconeogenesis
mox00052  Galactose metabolism
mox00500  Starch and sucrose metabolism
mox00520  Amino sugar and nucleotide sugar metabolism
mox00521  Streptomycin biosynthesis
mox01100  Metabolic pathways
mox01110  Biosynthesis of secondary metabolites
mox01120  Microbial metabolism in diverse environments
mox01130  Biosynthesis of antibiotics
mox01200  Carbon metabolism
Module
mox_M00549  Nucleotide sugar biosynthesis, glucose => UDP-glucose
Brite
KEGG Orthology (KO) [BR:mox00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    DAMO_0484 (glk)
   00052 Galactose metabolism
    DAMO_0484 (glk)
   00500 Starch and sucrose metabolism
    DAMO_0484 (glk)
   00520 Amino sugar and nucleotide sugar metabolism
    DAMO_0484 (glk)
  Biosynthesis of other secondary metabolites
   00521 Streptomycin biosynthesis
    DAMO_0484 (glk)
   00524 Neomycin, kanamycin and gentamicin biosynthesis
    DAMO_0484 (glk)
Enzymes [BR:mox01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.2  glucokinase
     DAMO_0484 (glk)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Glucokinase ROK
Motif
Other DBs
NCBI-ProteinID: CBE67560
UniProt: D5MJX7
Position
complement(425254..426276)
Genome map
AA seq 340 aa AA seqDB search
MILAGDIGGTKTVIGLFGEAGNRLHAIREETFPSQHYNSLEEVLNQFMGPGPAASLSVAC
FGVAGPVIGGKSNATNLPWELDERSLAEALRVPRVKLLNDLEATAYGMLHLEPTDLCVLQ
PGSPRKGNIAVIAAGTGLGEAILYWDGKRYHPMATEGGHADFAPRSDIEVDLLRYLQREF
GHVSYERLLSGPGLFNIYRFLRDSGIAREPEWLRTRIAEDDAGAVISEIGLAGDDPLCTK
ALDLFVSMYGSEAGNLTLKAFAIGGVYVGGGIAPKILAGAHDHAPLRSAFTRAFADKGRF
ADLLRSIEVKVALNLRAPLIGAAHYGLTAAYRRSLPPEGG
NT seq 1023 nt NT seq  +upstreamnt  +downstreamnt
atgatcttggccggcgacatcggggggacgaagaccgttatcggcctgtttggagaggcc
ggtaaccggctgcacgccatccgcgaagaaacgttccccagccaacattacaactcgctc
gaagaggtcctcaaccagttcatgggccctgggcctgccgcgtcactcagcgtggcctgc
ttcggggtggccggaccggtgatcggaggaaagagtaacgcgacaaatcttccctgggag
ttggatgagcgcagcctcgcggaagcccttcgcgttccgcgagtgaagctcctgaacgat
ctggaagcaacagcctacgggatgctgcatctcgagccgaccgacctgtgtgtgcttcag
ccgggttccccgcgcaagggtaatatcgccgtcatcgcggccggcacgggtttgggggag
gcgatcctctactgggacgggaagcgttatcatccaatggccaccgagggaggacacgct
gatttcgccccacgcagcgacatcgaggtcgacctgctgcgctatctccagcgggaattc
ggtcacgtgagttacgagcgactgctgtctggtccggggctcttcaacatctatcggttc
ctccgggacagcggcatagcccgagagccggagtggcttcggacgcgcattgcagaggat
gacgcaggcgcggtgatctctgagatcgggctggcaggggacgacccgctctgcacgaaa
gcgcttgatctgttcgtctctatgtacggatcggaggcgggcaatctgaccctgaaggca
ttcgccatcggtggggtgtatgtcgggggagggatcgcgccgaagatccttgcaggggca
catgaccacgcacccctacgcagtgcgttcacccgcgccttcgccgacaagggacgcttc
gccgacctgctccggtcaatcgaggtgaaggtcgcattaaacctgcgtgcacccctgatc
ggcgccgcccactatggcctcacagcggcctacaggcgctcgttaccgcctgaaggtggt
tga

DBGET integrated database retrieval system